BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001917-TA|BGIBMGA001917-PA|IPR013017|NHL, IPR011044|Quinoprotein amine dehydrogenase, beta chain-like, IPR001258|NHL repeat (492 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 8.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 8.5 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 8.5 Identities = 8/32 (25%), Positives = 18/32 (56%) Query: 253 IAFMKSQGEIYVTDKWKHCIHVFSKDGLYLRS 284 IA +K + +I +W C++++ G L++ Sbjct: 655 IAHLKDKKKIRAKKRWSQCMYMYFLLGFRLQA 686 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 8.5 Identities = 8/32 (25%), Positives = 18/32 (56%) Query: 253 IAFMKSQGEIYVTDKWKHCIHVFSKDGLYLRS 284 IA +K + +I +W C++++ G L++ Sbjct: 655 IAHLKDKKKIRAKKRWSQCMYMYFLLGFRLQA 686 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,624 Number of Sequences: 317 Number of extensions: 4948 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 492 length of database: 114,650 effective HSP length: 59 effective length of query: 433 effective length of database: 95,947 effective search space: 41545051 effective search space used: 41545051 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -