BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001915-TA|BGIBMGA001915-PA|IPR000243|Peptidase T1A, proteasome beta-subunit, IPR006593|Cytochrome b561 / ferric reductase transmembrane, IPR001353|20S proteasome, A and B subunits (424 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 4.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 7.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 7.2 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 23.0 bits (47), Expect = 4.1 Identities = 16/52 (30%), Positives = 24/52 (46%) Query: 197 VKILHLAVGRLYQVEYAMEAISHAGTSLGILATDGILLAAERRNTNKLLDEV 248 V HL+ R V Y ++ + G L ILA L E +T KL+ ++ Sbjct: 276 VFFFHLSDVRYVMVVYLLKNVVLYGLELFILAKIVTDLCQEANSTKKLIVKI 327 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 168 ALAFTLVSFISGIIALFSSK 187 A+ V F+ G++A+FS K Sbjct: 188 AMLTNAVCFVPGVVAMFSRK 207 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 168 ALAFTLVSFISGIIALFSSK 187 A+ V F+ G++A+FS K Sbjct: 188 AMLTNAVCFVPGVVAMFSRK 207 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.132 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,547 Number of Sequences: 317 Number of extensions: 3792 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 3 length of query: 424 length of database: 114,650 effective HSP length: 59 effective length of query: 365 effective length of database: 95,947 effective search space: 35020655 effective search space used: 35020655 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -