BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001914-TA|BGIBMGA001914-PA|IPR004877|Cytochrome b561, IPR006593|Cytochrome b561 / ferric reductase transmembrane (237 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 24 0.90 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 1.6 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.8 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 24.2 bits (50), Expect = 0.90 Identities = 13/40 (32%), Positives = 17/40 (42%) Query: 65 TNNLKQHIYLCVTGYVILMSQAILTFSPNNGWTNSLKYPN 104 TNN Y+C T VI+ + +S N W Y N Sbjct: 33 TNNEVPRWYICYTIGVIITIGCLCIWSIFNKWNQFRSYSN 72 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 63 HGTNNLKQHIYLCVTGYVILMSQAILTFSPNNGWT 97 H N + + V + L+SQA+ TF+ GWT Sbjct: 180 HQKNFINESNVETVKFNLFLLSQAVETFNDIFGWT 214 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 52 ALSAFIFANVFHGTNNLKQHIYLCVT 77 A + F+ +F+ +KQHIY ++ Sbjct: 10 AAAVFLLFYLFYCYKTIKQHIYSLIS 35 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/26 (30%), Positives = 15/26 (57%) Query: 52 ALSAFIFANVFHGTNNLKQHIYLCVT 77 A + F+ +F+ +KQHIY ++ Sbjct: 10 AAAVFLLFYLFYCYKTIKQHIYSLIS 35 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.328 0.137 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,156 Number of Sequences: 317 Number of extensions: 1208 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 237 length of database: 114,650 effective HSP length: 55 effective length of query: 182 effective length of database: 97,215 effective search space: 17693130 effective search space used: 17693130 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -