BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001913-TA|BGIBMGA001913-PA|IPR010294|ADAM-TS Spacer 1, IPR000884|Thrombospondin, type I (574 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 26 2.4 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 26 3.1 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 24 9.5 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 26.2 bits (55), Expect = 2.4 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Query: 501 VPARCTSKP-VINPNVISPPAVSDPQQRVTRHQINTPPHIRDRSYA 545 +PA P V+NP+ S P + PQQ+ Q PP DR+ A Sbjct: 371 IPAGSQPVPAVVNPHQQSRPTIPAPQQQTPPRQ---PPATGDRAPA 413 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.8 bits (54), Expect = 3.1 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Query: 501 VPARCTSKP-VINPNVISPPAVSDPQQRVTRHQINTPPHIRDRSYA 545 +PA P V+NP S P + PQQ+ Q PP DR+ A Sbjct: 372 IPAGSQPVPAVVNPQQPSRPTIPAPQQQTPPRQ---PPATGDRAPA 414 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 24.2 bits (50), Expect = 9.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 434 KPETERDCGGDCSPSWYLSDW 454 KP TERD + +WY S W Sbjct: 149 KPGTERDPPNNWVAAWYGSAW 169 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.135 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,942 Number of Sequences: 2123 Number of extensions: 27771 Number of successful extensions: 43 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 41 Number of HSP's gapped (non-prelim): 4 length of query: 574 length of database: 516,269 effective HSP length: 68 effective length of query: 506 effective length of database: 371,905 effective search space: 188183930 effective search space used: 188183930 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -