BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001910-TA|BGIBMGA001910-PA|IPR000832|GPCR, family 2, secretin-like, IPR002001|Diuretic hormone receptor (213 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 5.5 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 5.5 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 7.3 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 9.7 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 49 EQYRKATKALLVLIPLLGI 67 + + + TK+LLVL ++G+ Sbjct: 47 DNFYQTTKSLLVLFQIMGV 65 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 49 EQYRKATKALLVLIPLLGI 67 + + + TK+LLVL ++G+ Sbjct: 47 DNFYQTTKSLLVLFQIMGV 65 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.0 bits (42), Expect = 7.3 Identities = 12/50 (24%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 61 LIPLLGITNLLVLCGPSDDSWFAYSFDYARALMLSTQGFTVALFYCFMNT 110 L+P+ G+T+ C + SW++ Y++ ++ + T FY +N+ Sbjct: 209 LLPVNGVTS--EKCNLTF-SWYSKKVFYSKIIISGSIFMTTTSFYRILNS 255 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Query: 144 SPRSRTESIRSYSKKLT 160 SP ES SY KKLT Sbjct: 722 SPLFPLESATSYQKKLT 738 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.325 0.135 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,542 Number of Sequences: 317 Number of extensions: 1384 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 4 length of query: 213 length of database: 114,650 effective HSP length: 54 effective length of query: 159 effective length of database: 97,532 effective search space: 15507588 effective search space used: 15507588 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -