GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001909-TA|BGIBMGA001909-PA|undefined
         (115 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    22   1.6  

>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 22.2 bits (45), Expect = 1.6
 Identities = 14/57 (24%), Positives = 24/57 (42%)

Query: 57  VPTEEVAKLSALIGVTESLAPSIYMPASSYIYMSTIETFPGAFYLFDAALTVVALCL 113
           +P++   K+S  I +  SL     + A      S +    G F LF   L   ++C+
Sbjct: 264 LPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICV 320


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.326    0.136    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,616
Number of Sequences: 429
Number of extensions: 876
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 115
length of database: 140,377
effective HSP length: 50
effective length of query: 65
effective length of database: 118,927
effective search space:  7730255
effective search space used:  7730255
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (21.2 bits)
S2: 39 (19.8 bits)