BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001908-TA|BGIBMGA001908-PA|IPR011701|Major facilitator superfamily MFS_1 (293 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 25 2.6 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 25.0 bits (52), Expect = 2.6 Identities = 21/88 (23%), Positives = 36/88 (40%), Gaps = 4/88 (4%) Query: 132 GAWS---DKYKKRKICIVFPFIGEILSNTGLLFATYYFQELSLTATALIEALPAAFT-GS 187 G W D + R C F+G + + L+ Y Q L + ++ +FT GS Sbjct: 70 GGWQGVKDGSEHRSTCPSGGFLGGVSGSEDCLYLNVYTQNLIGSRPVMVWIHGGSFTGGS 129 Query: 188 YVIIFMGMYSFMADRTTVESRTFRLGLV 215 G + M + V + +RLG++ Sbjct: 130 GNSWIYGPDNLMPEDVVVVTINYRLGIL 157 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.325 0.136 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,898 Number of Sequences: 2123 Number of extensions: 7954 Number of successful extensions: 16 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 1 length of query: 293 length of database: 516,269 effective HSP length: 63 effective length of query: 230 effective length of database: 382,520 effective search space: 87979600 effective search space used: 87979600 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -