GeneModel BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001908-TA|BGIBMGA001908-PA|IPR011701|Major facilitator
superfamily MFS_1
         (293 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_03_0094 + 12315923-12316237,12316347-12317504                       29   4.4  

>09_03_0094 + 12315923-12316237,12316347-12317504
          Length = 490

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 173 ATALIE-ALPAAFTG-SYVIIFMGMYSFMADRTTVESRTFRLGLVTICVTLGTPTGTALS 230
           AT LI  A+ AA  G    +    +Y+F+AD     SR    G + +   +GT  GT+L 
Sbjct: 100 ATLLIAMAVTAALNGVGLALQIPAIYAFVADSVDGTSRGVAFGWLMVAGKVGTVGGTSL- 158

Query: 231 GILL 234
           G+L+
Sbjct: 159 GLLM 162


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.325    0.136    0.398 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,340,973
Number of Sequences: 37544
Number of extensions: 214853
Number of successful extensions: 532
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 532
Number of HSP's gapped (non-prelim): 1
length of query: 293
length of database: 14,793,348
effective HSP length: 81
effective length of query: 212
effective length of database: 11,752,284
effective search space: 2491484208
effective search space used: 2491484208
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 60 (28.3 bits)