BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001899-TA|BGIBMGA001899-PA|undefined (1101 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 26 1.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 5.9 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 26.2 bits (55), Expect = 1.5 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 6/53 (11%) Query: 760 PGPLTIQVRGSPIETRRKIKDDFDPDTLDRKPKHEVKKRVEKILLKSAGSFKC 812 P T VRG+PI+T +KD P L+ E R+E + + G ++C Sbjct: 324 PATFTCNVRGNPIKTVSWLKDG-KPLGLE-----EAVLRIESVKKEDKGMYQC 370 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.2 bits (50), Expect = 5.9 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 262 DVEQNMSDNGS-AMEPRLDMSNVMMKTNPLLKLNGMGN 298 D++ +MSD S + + D N+MM T LL L G+ Sbjct: 346 DIDSHMSDRASVSSKNAADSDNMMMITPELLGLMPSGS 383 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.131 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 278,725 Number of Sequences: 429 Number of extensions: 11581 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 4 length of query: 1101 length of database: 140,377 effective HSP length: 65 effective length of query: 1036 effective length of database: 112,492 effective search space: 116541712 effective search space used: 116541712 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -