BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001897-TA|BGIBMGA001897-PA|IPR006768|Protein similar to CwfJ, C-terminal 1, IPR006767|Protein similar to CwfJ, C-terminal 2 (478 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 26 0.67 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 26 0.67 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 8.2 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 25.8 bits (54), Expect = 0.67 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 294 PLTPYHVLILPIQHHQSTTRAPDDVIKEITKFKDTLKK 331 PL + VL+ Q D +KE+ F++TLKK Sbjct: 249 PLMDFSVLVEACGVLQQEPHRRDAFLKEVADFQETLKK 286 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 25.8 bits (54), Expect = 0.67 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 294 PLTPYHVLILPIQHHQSTTRAPDDVIKEITKFKDTLKK 331 PL + VL+ Q D +KE+ F++TLKK Sbjct: 249 PLMDFSVLVEACGVLQQEPHRRDAFLKEVADFQETLKK 286 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.2 bits (45), Expect = 8.2 Identities = 13/42 (30%), Positives = 20/42 (47%) Query: 344 ERNYRTSHMQIQCVPVPRASELQILEVFQDEAGIASIQMEVL 385 ER+ R +H+Q Q A + Q+E G S +E+L Sbjct: 72 ERDERLAHVQAQLGAAMGAVGTALTFCLQEEGGTTSQLIELL 113 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.136 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,130 Number of Sequences: 317 Number of extensions: 5717 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 3 length of query: 478 length of database: 114,650 effective HSP length: 59 effective length of query: 419 effective length of database: 95,947 effective search space: 40201793 effective search space used: 40201793 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -