BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001895-TA|BGIBMGA001895-PA|undefined (641 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 25 1.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 25 1.4 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 4.4 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 23 7.7 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 25.4 bits (53), Expect = 1.4 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 207 PRANSVNLPSASSHNDLEAYSHDIPSTSN 235 P + N P+ + + L+ Y+HDIP T N Sbjct: 238 PLSGETNDPNKTEYT-LKIYTHDIPETYN 265 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 25.4 bits (53), Expect = 1.4 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 207 PRANSVNLPSASSHNDLEAYSHDIPSTSN 235 P + N P+ + + L+ Y+HDIP T N Sbjct: 238 PLSGETNDPNKTEYT-LKIYTHDIPETYN 265 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Query: 463 FPTY-PERAVSLSHWLADWISLGAIP 487 F TY P + + W+A WI AIP Sbjct: 218 FHTYIPSALIVVMSWIAFWIKPEAIP 243 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/42 (21%), Positives = 20/42 (47%) Query: 191 ENEPVMMSPSPENVSAPRANSVNLPSASSHNDLEAYSHDIPS 232 +NE ++S ++ +AP V++ + N + IP+ Sbjct: 64 DNETPVVSQGSDSYTAPDGQQVSITYVADENGFQVQGSHIPT 105 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.314 0.130 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,397 Number of Sequences: 429 Number of extensions: 8885 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 4 length of query: 641 length of database: 140,377 effective HSP length: 62 effective length of query: 579 effective length of database: 113,779 effective search space: 65878041 effective search space used: 65878041 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -