BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001894-TA|BGIBMGA001894-PA|undefined (302 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 4.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 7.7 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 4.4 Identities = 12/49 (24%), Positives = 22/49 (44%) Query: 20 RHVTGDPIALIYNEGLWKINKVSPLYNLQYNGIKLKQYGSKILQALVSS 68 R G ++Y L K N++S ++N + K + S Q ++ S Sbjct: 725 RFAAGFCFTVVYAALLTKTNRISRIFNASKHSAKRPSFISPRSQLIICS 773 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 7.7 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Query: 38 INKVSPLYNLQYNGIKLKQYGSKILQALVSSLQMSNTAKYT---VVLEELPLLK 88 I+ + Y L +GI +++ G +I +S+L+ N + T +V EL LK Sbjct: 260 IDIIKVQYELAKHGIVIEELGGEIQCVKISALKGINLRELTEAIIVQAELMDLK 313 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.134 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,991 Number of Sequences: 429 Number of extensions: 3060 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 302 length of database: 140,377 effective HSP length: 57 effective length of query: 245 effective length of database: 115,924 effective search space: 28401380 effective search space used: 28401380 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -