BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001894-TA|BGIBMGA001894-PA|undefined (302 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70230.1 68414.m08081 expressed protein 29 3.8 >At1g70230.1 68414.m08081 expressed protein Length = 416 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 11 EQEEDGNTSRHVTGDPIALIYNEGLWKINKVSPLYN 46 ++EE + H+ +P+ Y +G W +++ PLYN Sbjct: 62 QEEESQESFDHIQDEPLC-DYTQGNWVRDEIGPLYN 96 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,795,696 Number of Sequences: 28952 Number of extensions: 265213 Number of successful extensions: 571 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 571 Number of HSP's gapped (non-prelim): 1 length of query: 302 length of database: 12,070,560 effective HSP length: 81 effective length of query: 221 effective length of database: 9,725,448 effective search space: 2149324008 effective search space used: 2149324008 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -