SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001893-TA|BGIBMGA001893-PA|IPR004365|nucleic acid
binding, OB-fold, tRNA/helicase-type, IPR008994|Nucleic acid-binding,
OB-fold
         (127 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z77134-1|CAB00871.1|  293|Caenorhabditis elegans Hypothetical pr...    26   9.5  

>Z77134-1|CAB00871.1|  293|Caenorhabditis elegans Hypothetical
           protein R09H10.2 protein.
          Length = 293

 Score = 25.8 bits (54), Expect = 9.5
 Identities = 13/45 (28%), Positives = 21/45 (46%)

Query: 8   YFIKDLINKPTPIDVWLQGTIEQTVGRDILIISDTFGRAKITKCE 52
           YF+K L+N+    D+W+ G   +    D       F +  IT C+
Sbjct: 191 YFLKKLVNRTFIDDIWIDGEGAEYGLFDHFYNGGAFDQNGITFCQ 235


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.319    0.138    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,259,919
Number of Sequences: 27539
Number of extensions: 122296
Number of successful extensions: 240
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 240
Number of HSP's gapped (non-prelim): 1
length of query: 127
length of database: 12,573,161
effective HSP length: 73
effective length of query: 54
effective length of database: 10,562,814
effective search space: 570391956
effective search space used: 570391956
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 54 (25.8 bits)

- SilkBase 1999-2023 -