BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001893-TA|BGIBMGA001893-PA|IPR004365|nucleic acid
binding, OB-fold, tRNA/helicase-type, IPR008994|Nucleic acid-binding,
OB-fold
(127 letters)
Database: celegans
27,539 sequences; 12,573,161 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z77134-1|CAB00871.1| 293|Caenorhabditis elegans Hypothetical pr... 26 9.5
>Z77134-1|CAB00871.1| 293|Caenorhabditis elegans Hypothetical
protein R09H10.2 protein.
Length = 293
Score = 25.8 bits (54), Expect = 9.5
Identities = 13/45 (28%), Positives = 21/45 (46%)
Query: 8 YFIKDLINKPTPIDVWLQGTIEQTVGRDILIISDTFGRAKITKCE 52
YF+K L+N+ D+W+ G + D F + IT C+
Sbjct: 191 YFLKKLVNRTFIDDIWIDGEGAEYGLFDHFYNGGAFDQNGITFCQ 235
Database: celegans
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 12,573,161
Number of sequences in database: 27,539
Lambda K H
0.319 0.138 0.416
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,259,919
Number of Sequences: 27539
Number of extensions: 122296
Number of successful extensions: 240
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 240
Number of HSP's gapped (non-prelim): 1
length of query: 127
length of database: 12,573,161
effective HSP length: 73
effective length of query: 54
effective length of database: 10,562,814
effective search space: 570391956
effective search space used: 570391956
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 54 (25.8 bits)
- SilkBase 1999-2023 -