BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001892-TA|BGIBMGA001892-PA|IPR000834|Peptidase M14, carboxypeptidase A (298 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.1 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 22 4.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.4 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 8.4 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/48 (27%), Positives = 22/48 (45%) Query: 152 FIQNALKKYQKNAKIYLSIRRDGHSIAYPYGYSKTAPSNEAKLKRVAS 199 FI+N + + A++ L R + I + + P N LK +AS Sbjct: 391 FIRNDQESAEATAELKLGGRFEPPQIRHAFNEETVQPGNSVFLKCIAS 438 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 26 INKEVEKAKEDLKPV 40 + +EVEKAK DL V Sbjct: 90 LRREVEKAKRDLSSV 104 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 141 GAAAASENETIFIQNALKK 159 GAA S+ T+F+ + +KK Sbjct: 74 GAAVVSKGTTLFMTSQIKK 92 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 141 GAAAASENETIFIQNALKK 159 GAA S+ T+F+ + +KK Sbjct: 74 GAAVVSKGTTLFMTSQIKK 92 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 205 VNQKTNGIYLFVNTSIYELEGKQ 227 + + NGIYL+ + + LEG++ Sbjct: 4 LGESPNGIYLYHDGRVKLLEGRR 26 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.135 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,771 Number of Sequences: 317 Number of extensions: 3215 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 5 length of query: 298 length of database: 114,650 effective HSP length: 56 effective length of query: 242 effective length of database: 96,898 effective search space: 23449316 effective search space used: 23449316 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -