BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001891-TA|BGIBMGA001891-PA|IPR000834|Peptidase M14, carboxypeptidase A, IPR009020|Proteinase inhibitor, propeptide (418 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 23 3.1 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 23 5.4 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 7.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 7.1 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 9.4 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 9.4 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 9.4 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 23.4 bits (48), Expect = 3.1 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Query: 188 NDPEAKNDLNGVDWYIL---PVVNPDGYEYTRNSRNNRLWRKTRSKHANCYGVDGNRNY 243 N PE + LNG+ YI+ P + + + R+N K K Y G NY Sbjct: 98 NSPEKRLTLNGIYEYIMRNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNY 156 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 22.6 bits (46), Expect = 5.4 Identities = 6/12 (50%), Positives = 12/12 (100%) Query: 10 IEIIHLCSYTLI 21 IE++++CSYT++ Sbjct: 175 IEVLYICSYTVL 186 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 7.1 Identities = 14/32 (43%), Positives = 16/32 (50%) Query: 93 SPERVPRRRLLRGLNVFEYNSHAAIQDYLDTV 124 S ERV RRRL R L + S QD +V Sbjct: 27 SSERVTRRRLRRPLKTTQSVSVTKDQDVSSSV 58 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.2 bits (45), Expect = 7.1 Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Query: 254 YNPCNKETYAGPEPFSEPETQIVRNIMMENAKR---MKLYVSIHSYGQYLVYP 303 +NP + P F+ N ++ A+ +K+Y +H YG + P Sbjct: 349 HNPMSHHLKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNTLSP 401 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 9.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 73 AQNTNLTYEIKRRNYGRSFESPERVPRRRLL 103 AQ N +++ R NY E R P R+L Sbjct: 67 AQPLNELFDVTRDNYRHITELKRRFPGLRVL 97 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.8 bits (44), Expect = 9.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 207 VNPDGYEYTRNSRNNRLWRKTRSKHAN 233 +N D ++ R RN+ L R+ S + N Sbjct: 105 MNKDAVQHERGPRNSTLRRQQMSSYYN 131 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.8 bits (44), Expect = 9.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 207 VNPDGYEYTRNSRNNRLWRKTRSKHAN 233 +N D ++ R RN+ L R+ S + N Sbjct: 105 MNKDAVQHERGPRNSTLRRQQMSSYYN 131 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,860 Number of Sequences: 317 Number of extensions: 4447 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 7 length of query: 418 length of database: 114,650 effective HSP length: 58 effective length of query: 360 effective length of database: 96,264 effective search space: 34655040 effective search space used: 34655040 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -