BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001891-TA|BGIBMGA001891-PA|IPR000834|Peptidase M14, carboxypeptidase A, IPR009020|Proteinase inhibitor, propeptide (418 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 8.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 8.5 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 8.5 Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 265 PEPFSEPETQIVRNIMMENAKR 286 P+P E +RNI+++N K+ Sbjct: 192 PQPIESFEAAGLRNIVLDNIKK 213 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 8.5 Identities = 11/46 (23%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Query: 22 RLFPETTSQLENITRFEDVDNQVEILKQSRGIND----SLDLIVPP 63 ++FP T +EN+ R D + + ++G + + ++VPP Sbjct: 538 KVFPNGTLIIENVERMSDQATYTCVARNAQGYSARGTLEVQVMVPP 583 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.138 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,825 Number of Sequences: 429 Number of extensions: 6050 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 418 length of database: 140,377 effective HSP length: 59 effective length of query: 359 effective length of database: 115,066 effective search space: 41308694 effective search space used: 41308694 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -