BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001890-TA|BGIBMGA001890-PA|IPR000834|Peptidase M14, carboxypeptidase A (353 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 22 5.8 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 5.8 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 38 ILEIMSAFPNANVTYEVIGRTASYNDILLLKVTELKR 74 +L+ P ++ IGR ASY + K+ +++R Sbjct: 49 VLQYPGCVPKPIPSFACIGRCASYIQVSGSKIWQMER 85 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/27 (29%), Positives = 16/27 (59%) Query: 276 QVETLQNWYGKISGTSVDYASTIYGIP 302 +VE +++ G+ +DY T+Y +P Sbjct: 115 KVEIVRSQEGRFEEAVIDYLFTVYLLP 141 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,959 Number of Sequences: 317 Number of extensions: 3780 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 353 length of database: 114,650 effective HSP length: 57 effective length of query: 296 effective length of database: 96,581 effective search space: 28587976 effective search space used: 28587976 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -