BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001890-TA|BGIBMGA001890-PA|IPR000834|Peptidase M14, carboxypeptidase A (353 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 25 0.75 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 25 0.75 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.75 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 4.0 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 5.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 5.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 5.3 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 25.4 bits (53), Expect = 0.75 Identities = 9/41 (21%), Positives = 20/41 (48%) Query: 245 TDVQIDDDKYFDLKAEIEEAMKNSSFQNAAVQVETLQNWYG 285 T+ + ++ ++K E+ +K + AAV + W+G Sbjct: 85 TEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 125 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 25.4 bits (53), Expect = 0.75 Identities = 9/41 (21%), Positives = 20/41 (48%) Query: 245 TDVQIDDDKYFDLKAEIEEAMKNSSFQNAAVQVETLQNWYG 285 T+ + ++ ++K E+ +K + AAV + W+G Sbjct: 101 TEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 141 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 25.4 bits (53), Expect = 0.75 Identities = 9/41 (21%), Positives = 20/41 (48%) Query: 245 TDVQIDDDKYFDLKAEIEEAMKNSSFQNAAVQVETLQNWYG 285 T+ + ++ ++K E+ +K + AAV + W+G Sbjct: 158 TEPPYSETRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.0 bits (47), Expect = 4.0 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Query: 13 EDSTDTNLTKGITSQKLSPYTIKQQILEIMSAFP--NANVTYEVIGRTASYNDILLLKVT 70 E S DT+L +G +++ +++ LEI P + T EV + D++L++ T Sbjct: 112 ESSDDTSLFRGPKGIQINATELQKIKLEIHRDLPGKSTTTTVEVKRDIINPEDVILIRRT 171 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 285 GKISGTSVDYASTIYGIPFAMELVMQTYAN 314 G+I+ T V Y +G+P + + T N Sbjct: 249 GEIAWTKVIYVKRFFGLPVGVTAAIPTSEN 278 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 285 GKISGTSVDYASTIYGIPFAMELVMQTYAN 314 G+I+ T V Y +G+P + + T N Sbjct: 249 GEIAWTKVIYVKRFFGLPVGVTAAIPTSEN 278 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 5.3 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 285 GKISGTSVDYASTIYGIPFAMELVMQTYAN 314 G+I+ T V Y +G+P + + T N Sbjct: 249 GEIAWTKVIYVKRFFGLPVGVTAAIPTSEN 278 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,818 Number of Sequences: 429 Number of extensions: 4586 Number of successful extensions: 24 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 7 length of query: 353 length of database: 140,377 effective HSP length: 58 effective length of query: 295 effective length of database: 115,495 effective search space: 34071025 effective search space used: 34071025 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -