BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001889-TA|BGIBMGA001889-PA|undefined (112 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0512 - 24460391-24462337 32 0.12 09_03_0166 + 12956794-12956832,12956936-12956977,12957084-129571... 30 0.36 03_03_0248 + 15819264-15819460,15820691-15820729,15820797-158209... 30 0.48 11_06_0182 + 20997071-20997832,20998010-20998150 29 0.63 06_01_1174 - 10025086-10027217,10027271-10027333,10027704-10027866 29 0.84 01_05_0167 + 18849791-18849973,18850081-18850250,18850341-188504... 29 0.84 07_01_1089 + 10004773-10004831,10004924-10005033,10005631-100057... 27 2.6 03_05_1007 - 29637911-29638333,29640095-29640282,29640688-296407... 27 2.6 02_05_1041 - 33713561-33714564,33714844-33714904,33715640-337159... 27 2.6 01_01_0902 - 7099260-7099778,7100291-7100704,7101579-7102010 27 2.6 07_03_1214 + 24931142-24932314,24934177-24934434 27 3.4 03_02_0829 - 11599665-11600364,11600853-11601076,11601786-116020... 27 3.4 02_05_0484 - 29401195-29401404,29401572-29401755,29401866-294039... 27 3.4 06_03_1454 - 30261240-30261470,30261896-30262615,30262700-302628... 27 4.5 04_04_1057 - 30451759-30452523,30452627-30452701,30453180-304532... 27 4.5 04_03_0649 - 18402976-18403220,18403305-18404499 27 4.5 04_03_0434 + 15889712-15889797,15890086-15890287,15891184-158913... 27 4.5 12_01_0818 + 7524549-7524747,7524855-7525863,7525964-7526108,752... 26 5.9 08_02_0747 - 20728073-20728081,20728167-20728353,20728810-207289... 26 5.9 07_01_1164 - 11016314-11017688,11019144-11019181 26 5.9 04_01_0314 - 4243928-4244361,4245178-4245415 26 5.9 03_05_0654 + 26479416-26479605,26480058-26480246,26480674-264809... 26 5.9 09_06_0211 + 21601321-21601807,21601982-21602265,21603337-21603666 26 7.8 06_01_0497 + 3555919-3557154,3557815-3558143,3558177-3558775,355... 26 7.8 05_06_0234 - 26602660-26602728,26602814-26602988,26603077-266031... 26 7.8 05_04_0084 - 17788077-17789240 26 7.8 03_06_0146 - 31976538-31978643,31978653-31978751 26 7.8 03_05_0001 - 19386264-19386284,19386446-19386517,19386614-193873... 26 7.8 02_05_0415 + 28787353-28787496,28787658-28788204,28788297-287883... 26 7.8 02_03_0390 + 18448671-18448889,18449567-18449632,18449702-184497... 26 7.8 01_06_0213 + 27580635-27581105,27581206-27581298,27581376-275815... 26 7.8 >11_06_0512 - 24460391-24462337 Length = 648 Score = 31.9 bits (69), Expect = 0.12 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 7/76 (9%) Query: 23 DGQDFSDAESDDDIEKVQSIRNFLSEPLSNVETSFSP---QIYQFSSPVNEHVTNIVNRQ 79 D + F AES D+ ++ SIR+ + E L + +I P+ E V +++N Sbjct: 38 DAKSFRGAESSSDLAQLDSIRDMMRE-LQAIFVKMGENERRIVHLFDPIEELVDDVLNSL 96 Query: 80 P---EISNPQPSISGM 92 EIS QP ++G+ Sbjct: 97 AAGGEISTLQPKLAGV 112 >09_03_0166 + 12956794-12956832,12956936-12956977,12957084-12957149, 12957237-12957350,12957435-12957515,12957613-12957690, 12958702-12958784,12959645-12959726,12959801-12959901, 12960016-12960055,12960162-12960221,12960302-12960348, 12960437-12960575,12960716-12960931,12961010-12961344, 12961525-12961596,12962449-12962589,12962680-12962716, 12962837-12963256 Length = 730 Score = 30.3 bits (65), Expect = 0.36 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Query: 7 RDEDIEGFWDIPSGSEDGQDFSDAESDDDIEKVQSIRNFLSEPLSNVETSFSPQIYQFS 65 R I+ W+ GS D D + DD V S N +SEP N E+ F Q S Sbjct: 293 RSSKIKPLWE---GSCDEDDMCEFADKDDCPAVGSSYNPMSEPFDNWESKFDASPEQTS 348 >03_03_0248 + 15819264-15819460,15820691-15820729,15820797-15820936, 15821150-15821225,15822866-15823160,15823236-15823342, 15823442-15823489,15823568-15823853,15823954-15823961, 15824083-15824184,15824426-15824553,15824664-15824741, 15825047-15825145,15825247-15825302 Length = 552 Score = 29.9 bits (64), Expect = 0.48 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 5/81 (6%) Query: 20 GSEDGQDFSDAESDDDIEKVQSIRNFLS-----EPLSNVETSFSPQIYQFSSPVNEHVTN 74 G+E+ +D E D++ E + + F S E + ++ F + Y + +++ Sbjct: 175 GNEESEDLKSDEEDEEEEDEEDEKGFSSDDSSDERMESIAKEFGVKRYNWLVYMDKKAKE 234 Query: 75 IVNRQPEISNPQPSISGMTSR 95 RQ EI PSI ++ R Sbjct: 235 EEKRQKEIIKGDPSIKKLSRR 255 >11_06_0182 + 20997071-20997832,20998010-20998150 Length = 300 Score = 29.5 bits (63), Expect = 0.63 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 7 RDEDIEGFWDIPSGSEDGQDFSDAESDDDIE 37 R +D+ WD+P G ED D+ES+ D E Sbjct: 215 RSDDLPK-WDVPEGDEDDDHSFDSESEFDSE 244 >06_01_1174 - 10025086-10027217,10027271-10027333,10027704-10027866 Length = 785 Score = 29.1 bits (62), Expect = 0.84 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 1 MSLRRLRDEDIEGFWDIPSGSEDGQDFS-DAESDDDIEKVQSIRNF 45 M RRL E E +I SG ED F D E D ++ K Q +F Sbjct: 584 MEARRLAIEREESSTEIDSGDEDAIQFELDCEDDHEMLKAQPAYHF 629 >01_05_0167 + 18849791-18849973,18850081-18850250,18850341-18850413, 18850729-18850839,18850947-18850992,18851085-18851148, 18851810-18851912,18851999-18852094,18852186-18852215, 18852434-18852533,18852761-18852845,18852965-18853088 Length = 394 Score = 29.1 bits (62), Expect = 0.84 Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 12 EGFWDIPSGSEDGQDFSDAESDDDIEKVQSIRNFLSE 48 E F+ SGSED + S + DDD E+ + + E Sbjct: 43 ESFYSARSGSEDDRQVSSSNDDDDSEEEEQEEREMDE 79 >07_01_1089 + 10004773-10004831,10004924-10005033,10005631-10005749, 10005833-10005930,10006834-10006921,10006993-10007127, 10007211-10007313,10007506-10007618,10007821-10007868 Length = 290 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Query: 9 EDIEGFWDIPSGSEDGQDFSDAESDDD 35 EDIE F +P ED D +D E+D+D Sbjct: 219 EDIEDFGGLPDDDED--DDNDGETDED 243 >03_05_1007 - 29637911-29638333,29640095-29640282,29640688-29640773, 29641108-29641173,29641289-29641331,29641398-29642328 Length = 578 Score = 27.5 bits (58), Expect = 2.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 8 DEDIEGFWDIPSGSEDGQDFSDAESDD 34 + ++ G IP G E+ FSD E DD Sbjct: 550 EAELSGHTTIPIGDEEDVSFSDLEDDD 576 >02_05_1041 - 33713561-33714564,33714844-33714904,33715640-33715951, 33716780-33716917 Length = 504 Score = 27.5 bits (58), Expect = 2.6 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Query: 8 DEDIEGFWDIPSGSEDGQDFSDAESDDDIEKVQSIRNFLSEPLSNVET 55 DED EG S S++G DFS+ +D Q + S+ LS V+T Sbjct: 250 DEDGEG-----SSSDEGSDFSEDGDQEDESVHQGLGLLESKNLSGVQT 292 >01_01_0902 - 7099260-7099778,7100291-7100704,7101579-7102010 Length = 454 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 51 SNVETSFSPQIYQFSSPVNEHVTNIVNRQ 79 S VE + S + + P+NEH +IVNR+ Sbjct: 329 SVVELAASSDVLVVACPLNEHTRHIVNRE 357 >07_03_1214 + 24931142-24932314,24934177-24934434 Length = 476 Score = 27.1 bits (57), Expect = 3.4 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Query: 8 DED-IEGFWDIPSGS---EDGQDFSDAESDDDIEKVQ 40 DED + D+PS S EDG + D E D+D E+V+ Sbjct: 285 DEDAVVEVHDVPSSSDEEEDGIEEEDEEEDEDEEEVE 321 >03_02_0829 - 11599665-11600364,11600853-11601076,11601786-11602000, 11602300-11602377,11602593-11603907 Length = 843 Score = 27.1 bits (57), Expect = 3.4 Identities = 13/40 (32%), Positives = 20/40 (50%) Query: 2 SLRRLRDEDIEGFWDIPSGSEDGQDFSDAESDDDIEKVQS 41 ++RR RDE D +G++ AES+DD + S Sbjct: 221 NVRRFRDEKTSDLKDAEKSPINGREDDFAESEDDFDNPSS 260 >02_05_0484 - 29401195-29401404,29401572-29401755,29401866-29403973, 29404320-29404403,29404507-29404777,29404864-29405117, 29405513-29405722,29406357-29406503 Length = 1155 Score = 27.1 bits (57), Expect = 3.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Query: 18 PSGSEDGQDFSDAESDDDIEKVQSI 42 PSGSE G + D E DD + QSI Sbjct: 1121 PSGSELGAEQDDEEDDDSERRNQSI 1145 >06_03_1454 - 30261240-30261470,30261896-30262615,30262700-30262843, 30262953-30263204,30263542-30263751 Length = 518 Score = 26.6 bits (56), Expect = 4.5 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 16 DIPSGSEDGQDFSDAESDDDIEKVQSIRNFLSEPLSNVE 54 D S ED +D D + DDD ++ + ++E +S E Sbjct: 469 DFDSSEEDDEDDDDDDDDDDDDEEDGLSVSINEDMSYEE 507 >04_04_1057 - 30451759-30452523,30452627-30452701,30453180-30453254, 30453503-30453591,30454058-30454157,30454244-30454388, 30454609-30454658,30455033-30455114,30455200-30455282, 30455360-30455429,30455523-30455632,30455719-30455872, 30456639-30456796,30457338-30457517 Length = 711 Score = 26.6 bits (56), Expect = 4.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Query: 78 RQPEISNPQPSISGMTSRTTTSPLHNLR 105 R PE S P PS SG T S LH ++ Sbjct: 30 RSPEASLPSPSSSGNGVATRISNLHGVK 57 >04_03_0649 - 18402976-18403220,18403305-18404499 Length = 479 Score = 26.6 bits (56), Expect = 4.5 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query: 54 ETSFSPQIYQFSSPVNEHVTNIVNRQPEISNPQPSISGMTSRTTTSPLHNL 104 +T SP+ + + V R P + +P P+ + M+S +TTS L Sbjct: 405 QTKISPEFKNVTGGARQTQAP-VQRPPALQSPAPTTAPMSSSSTTSSFSRL 454 >04_03_0434 + 15889712-15889797,15890086-15890287,15891184-15891323, 15891420-15891559,15891762-15891913,15892773-15892902, 15892990-15893141 Length = 333 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 7 RDEDIEGFWDIPSGSEDGQDFSDAESDDDIE 37 +D+ E W+ + +ED F E D+DIE Sbjct: 185 KDQVAESKWENEAAAEDLDGFDGDEEDEDIE 215 >12_01_0818 + 7524549-7524747,7524855-7525863,7525964-7526108, 7526206-7526295,7526404-7526553,7527333-7528094, 7528177-7528496,7528581-7528707,7528792-7528959, 7529054-7530466,7530563-7530823,7530983-7531144, 7531976-7532121,7532601-7532667,7533483-7533587 Length = 1707 Score = 26.2 bits (55), Expect = 5.9 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 7/61 (11%) Query: 55 TSFSPQIYQFSSPVNEHVTNIVN------RQPEISNPQPSISGMTSRTTTSPLHNLRNLD 108 + F I Q S P +H NI+ Q + NP+ S+ S+ TS H R LD Sbjct: 601 SKFCSDIAQNSDPT-QHALNILASDGQYVNQDDFVNPEKSVCMHDSKIETSREHADRKLD 659 Query: 109 D 109 D Sbjct: 660 D 660 >08_02_0747 - 20728073-20728081,20728167-20728353,20728810-20728913, 20729008-20729139,20729583-20729810,20730263-20730358, 20730440-20730511,20730588-20730760,20730947-20731000, 20731086-20731134,20731228-20731326,20731420-20731511, 20731607-20731832,20731927-20732100,20732186-20732809, 20732890-20733033,20733108-20733218,20733516-20733650, 20733963-20733989 Length = 911 Score = 26.2 bits (55), Expect = 5.9 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 6/70 (8%) Query: 19 SGSEDGQDFSDAESDDDIEKVQSIRNFLSEPLSNVETSFS----PQIYQFSSPVNEHVTN 74 SG E + + +DD + VQ NF S P N +T P + +PVN+ + Sbjct: 480 SGIEPDHEPVEENNDDVNQAVQKNNNFTSSPKGNSKTVLDDDKLPIPNEEFNPVNK--ST 537 Query: 75 IVNRQPEISN 84 I+N EI + Sbjct: 538 ILNSSEEIKH 547 >07_01_1164 - 11016314-11017688,11019144-11019181 Length = 470 Score = 26.2 bits (55), Expect = 5.9 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query: 24 GQDFSDAE-SDDDIEKVQSIRNFLSEPLSNVETSFSPQIYQFSSPVNEHV 72 G D +A SDD + + + + + + +VET S Y+F SP+ +H+ Sbjct: 132 GMDKDEASYSDDAVRRFEWFADKAGKFVRDVETGCSLAHYRFFSPLIKHL 181 >04_01_0314 - 4243928-4244361,4245178-4245415 Length = 223 Score = 26.2 bits (55), Expect = 5.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 81 EISNPQPSISGMTSRTTTS 99 EI+NPQ S+S + TTTS Sbjct: 103 EINNPQKSVSKLRHNTTTS 121 >03_05_0654 + 26479416-26479605,26480058-26480246,26480674-26480989, 26481286-26481844 Length = 417 Score = 26.2 bits (55), Expect = 5.9 Identities = 7/34 (20%), Positives = 22/34 (64%) Query: 2 SLRRLRDEDIEGFWDIPSGSEDGQDFSDAESDDD 35 ++ +++++ I W++P G G+ +++++ DD Sbjct: 363 NMAQMQEDSISSSWEMPQGGPLGEILTNSKNPDD 396 >09_06_0211 + 21601321-21601807,21601982-21602265,21603337-21603666 Length = 366 Score = 25.8 bits (54), Expect = 7.8 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query: 16 DIPSGSEDGQDFSDAESDDDIEKVQSIRNFLSE 48 D+P GS G +DA+++DD +K S F+S+ Sbjct: 313 DVPVGSTFGG--ADADAEDDPDKDDSWMQFISD 343 >06_01_0497 + 3555919-3557154,3557815-3558143,3558177-3558775, 3558919-3560393 Length = 1212 Score = 25.8 bits (54), Expect = 7.8 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Query: 8 DEDIEGFWD-IPSGS--EDGQDFSDAESDDD 35 DED WD + G +DG D +D ++DDD Sbjct: 861 DEDDTADWDAVDDGDAVDDGDDAADWDTDDD 891 >05_06_0234 - 26602660-26602728,26602814-26602988,26603077-26603120, 26603204-26603381,26603468-26603652,26603737-26603801, 26603985-26604066,26604342-26604434,26605096-26605191, 26605312-26605355,26605467-26605530 Length = 364 Score = 25.8 bits (54), Expect = 7.8 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Query: 7 RDEDIEGFWDIPSGSEDGQDFSDAESDDD 35 +DED EG D +D +D D E +DD Sbjct: 305 QDEDFEGIMD--DEDDDDEDDDDDEDEDD 331 >05_04_0084 - 17788077-17789240 Length = 387 Score = 25.8 bits (54), Expect = 7.8 Identities = 10/22 (45%), Positives = 15/22 (68%) Query: 19 SGSEDGQDFSDAESDDDIEKVQ 40 S S G+D SD + DDD ++V+ Sbjct: 118 SSSSSGEDASDDDDDDDDDEVE 139 >03_06_0146 - 31976538-31978643,31978653-31978751 Length = 734 Score = 25.8 bits (54), Expect = 7.8 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 6/104 (5%) Query: 8 DEDIEGFWDIPSGSEDGQDFSDAESDDDIEKVQSIRNFLSEPLSNV--ETSFSPQIYQFS 65 +ED G D+ + S++ + +D ESD + E + + E + E+ + +I Sbjct: 191 EEDDTGSSDLETDSDEYTESTDEESDYEEEDTTDLESDSDEDTESTDEESDYEEEI-DDE 249 Query: 66 SPVNEHVTNIVNRQPEISNPQPSISGMTSRTTTSPLHNLRNLDD 109 +E V +N E+ SG+ T H+ +LDD Sbjct: 250 EIDDESVEEDINLDDELMG---FASGLFGDDDTESSHDEEDLDD 290 >03_05_0001 - 19386264-19386284,19386446-19386517,19386614-19387357, 19387454-19388884,19388953-19389118,19392035-19392114, 19392393-19392462,19392550-19392761,19392837-19392890, 19393471-19393623,19393715-19393930,19394029-19394248, 19394332-19394399,19394510-19394643,19394755-19394854, 19394943-19395421,19395506-19395699,19396270-19396355, 19396364-19396444,19396842-19397023,19397305-19397346, 19398247-19398558,19399374-19399434,19399435-19399617, 19399744-19399863,19400380-19401051,19402597-19402668, 19402742-19402865,19403563-19403651,19405023-19405097 Length = 2170 Score = 25.8 bits (54), Expect = 7.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 82 ISNPQPSISGMTSRTTTSP 100 +SNPQPS+S M R P Sbjct: 2037 VSNPQPSLSSMQPRAPPPP 2055 >02_05_0415 + 28787353-28787496,28787658-28788204,28788297-28788392, 28788532-28788645,28788929-28789962,28790053-28790124 Length = 668 Score = 25.8 bits (54), Expect = 7.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 8 DEDIEGFWDIPSGSEDGQDFSDAESDDDIEKVQS 41 DE+ + D+PS ++ +FSD E++ D V S Sbjct: 505 DEEDDFSGDLPSDFDNADNFSDDETESDATVVIS 538 >02_03_0390 + 18448671-18448889,18449567-18449632,18449702-18449761, 18449864-18449959,18452287-18452447,18452669-18452790, 18452872-18453239,18453653-18453739,18453835-18453969, 18454349-18454471,18454771-18454854,18455023-18455187, 18455310-18455486,18455660-18455773,18455912-18456016, 18457056-18457174,18457244-18457385,18457461-18457555, 18457757-18457862,18458125-18458204,18458285-18458461, 18459828-18459912,18460024-18460104,18460208-18460351, 18460468-18460563,18460654-18460854,18461462-18461895, 18462417-18462478,18462622-18462872,18462956-18463030, 18463110-18463300,18463696-18463867,18463956-18464020, 18464646-18464778,18464861-18464962,18465047-18465130, 18465656-18465730,18465818-18465877,18465967-18466223, 18466560-18466608,18466781-18466941,18467013-18467079, 18467174-18467299,18467422-18467592,18468566-18468769, 18469059-18469165,18469608-18469737,18469774-18469959, 18470704-18470742 Length = 2202 Score = 25.8 bits (54), Expect = 7.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 71 HVTNIVNRQPEISNPQPSI 89 H IV R+P+ISNP P + Sbjct: 1126 HCQYIVAREPQISNPVPRV 1144 >01_06_0213 + 27580635-27581105,27581206-27581298,27581376-27581540, 27581640-27581862,27582329-27582429,27582666-27582713, 27583086-27583172,27583745-27583879,27583985-27584140, 27585336-27585545,27585641-27586351,27586429-27586974, 27587872-27588495,27588595-27588699,27590460-27590711, 27590939-27591766 Length = 1584 Score = 25.8 bits (54), Expect = 7.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 9 EDIEGFWDIPSGSEDGQDFSDAESDDDIE 37 E I F ++ S SE ++ +DAE D+D E Sbjct: 621 EKIRAFQNVISDSEAEKEANDAERDEDSE 649 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.311 0.129 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,568,628 Number of Sequences: 37544 Number of extensions: 146544 Number of successful extensions: 518 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 496 Number of HSP's gapped (non-prelim): 33 length of query: 112 length of database: 14,793,348 effective HSP length: 73 effective length of query: 39 effective length of database: 12,052,636 effective search space: 470052804 effective search space used: 470052804 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -