BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001885-TA|BGIBMGA001885-PA|IPR001781|LIM, zinc-binding (492 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39830.1 68415.m04892 LIM domain-containing protein contains ... 43 4e-04 At1g01780.1 68414.m00097 LIM domain-containing protein similar t... 39 0.007 At5g17890.1 68418.m02098 LIM domain-containing protein / disease... 39 0.009 At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 37 0.035 At5g66610.1 68418.m08396 LIM domain-containing protein contains ... 36 0.061 At3g61230.1 68416.m06852 LIM domain-containing protein similar t... 36 0.061 At2g40820.1 68415.m05038 proline-rich family protein contains pr... 36 0.061 At3g55770.1 68416.m06197 LIM domain-containing protein similar t... 35 0.11 At2g45800.1 68415.m05696 LIM domain-containing protein similar t... 35 0.11 At2g32840.2 68415.m04021 proline-rich family protein Common fam... 35 0.14 At2g32840.1 68415.m04020 proline-rich family protein Common fam... 35 0.14 At2g39900.1 68415.m04904 LIM domain-containing protein similar t... 34 0.19 At4g36860.1 68417.m05226 LIM domain-containing protein low simil... 33 0.33 At5g66630.1 68418.m08398 LIM domain-containing protein contains ... 33 0.57 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 32 0.99 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 31 1.3 At1g10200.1 68414.m01150 transcription factor LIM, putative stro... 31 1.3 At5g24370.1 68418.m02873 invertase/pectin methylesterase inhibit... 31 2.3 At2g38410.1 68415.m04718 VHS domain-containing protein / GAT dom... 31 2.3 At1g77250.1 68414.m08997 PHD finger family protein contains Pfam... 31 2.3 At2g25380.1 68415.m03039 zinc finger protein-related very low si... 30 3.0 At5g66620.1 68418.m08397 LIM domain-containing protein contains ... 30 4.0 At5g16910.1 68418.m01982 cellulose synthase family protein simil... 30 4.0 At3g45840.1 68416.m04961 DC1 domain-containing protein contains ... 30 4.0 At2g21830.1 68415.m02594 DC1 domain-containing protein contains ... 30 4.0 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 30 4.0 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 5.3 At3g60300.1 68416.m06740 RWD domain-containing protein contains ... 29 5.3 At3g42670.1 68416.m04437 SNF2 domain-containing protein / helica... 29 5.3 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 29 5.3 At1g68880.1 68414.m07883 bZIP transcription factor family protei... 29 5.3 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 7.0 At4g38870.1 68417.m05504 F-box family protein contains Pfam prof... 29 7.0 At3g62670.1 68416.m07040 two-component responsive regulator fami... 29 7.0 At3g57480.1 68416.m06399 zinc finger (C2H2 type, AN1-like) famil... 29 7.0 At2g41835.1 68415.m05170 zinc finger (C2H2 type, AN1-like) famil... 29 7.0 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 29 9.3 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 29 9.3 At3g48980.1 68416.m05350 expressed protein 29 9.3 At3g13840.1 68416.m01747 scarecrow transcription factor family p... 29 9.3 At2g20240.1 68415.m02365 expressed protein 29 9.3 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 29 9.3 >At2g39830.1 68415.m04892 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 503 Score = 43.2 bits (97), Expect = 4e-04 Identities = 44/178 (24%), Positives = 69/178 (38%), Gaps = 24/178 (13%) Query: 294 ICVKCGERI-SGENAGCTAMGNTYHVHCFTCQRCNVNLQGK--PFYD---VE-------N 340 IC C I SG GC MG +H CF C C + P D +E N Sbjct: 161 ICGGCNSDIGSGNYLGC--MGTFFHPECFRCHSCGYAITEHEIPTNDAGLIEYRCHPFWN 218 Query: 341 EPYCEADYYDTLEKCCVCRKIILDRILRATGKPYHPTCFSCVECGKSLDGIPFTVDAMNQ 400 + YC + YD +CC C ++ + T + C C+E I T + Sbjct: 219 QKYCPSHEYDKTARCCSCERLESWDVRYYTLEDGRSLCLECME-----TAITDTGECQPL 273 Query: 401 IHCIDDFHKKFAPRCCVCELPIMPEEGQEETVRVVALDRSFHVKCYRCEDCGLLLSSE 458 H I D+++ + ++P++ + + +V +H + E GL LS E Sbjct: 274 YHAIRDYYEGMYMKLDQ-QIPMLLVQREALNDAIVGEKNGYH---HMPETRGLCLSEE 327 >At1g01780.1 68414.m00097 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 205 Score = 39.1 bits (87), Expect = 0.007 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 351 TLEKCCVCRKII-LDRILRATGKPYHPTCFSCVECGKSL 388 TL+KC VC K + + +L G PYH +CF C C +L Sbjct: 6 TLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTL 44 Score = 33.1 bits (72), Expect = 0.43 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 6/64 (9%) Query: 351 TLEKCCVCRKII--LDRILRATGKPYHPTCFSCVECGKSLDGIPF-TVDAMNQIHCIDDF 407 T +KC C K + L++I + G+ +H TCF C G +L + ++D++ ++C F Sbjct: 100 TQDKCAACEKTVYPLEKI-QMEGECFHKTCFRCAHGGCTLTHSSYASLDSV--LYCRHHF 156 Query: 408 HKKF 411 ++ F Sbjct: 157 NQLF 160 Score = 30.3 bits (65), Expect = 3.0 Identities = 11/36 (30%), Positives = 16/36 (44%) Query: 313 GNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADY 348 G YH CF C C LQ + ++ YC+ + Sbjct: 27 GMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKTHF 62 >At5g17890.1 68418.m02098 LIM domain-containing protein / disease resistance protein-related low similarity to disease resistance protein RPP4 [Arabidopsis thaliana] GI:20270890; contains Pfam profiles PF00412: LIM domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1613 Score = 38.7 bits (86), Expect = 0.009 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 7/86 (8%) Query: 340 NEPYCEADYYDTLEKCCVCRKIILDRI-LRATGKPYHPTCFSCVECGKSLDGIPFTVDAM 398 ++ + E + L KC C+ I D I + A G +HP CF C+ C + + + D Sbjct: 1225 SKDHVEEEVNPPLSKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPI-AMNEISDLR 1283 Query: 399 NQIH--CIDDFHKKFAPRCCVCELPI 422 H C + P C VCE I Sbjct: 1284 GMYHKPCYKELRH---PNCYVCEKKI 1306 Score = 30.3 bits (65), Expect = 3.0 Identities = 27/110 (24%), Positives = 34/110 (30%), Gaps = 4/110 (3%) Query: 295 CVKCGERISGENAGCTAMGNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADYYDTLE- 353 C C I + A G+ +H CF C RC + D+ Y + Y + Sbjct: 1240 CKDCKSAIE-DGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRG-MYHKPCYKELRHP 1297 Query: 354 KCCVCRKIILDRILRATGKPYHPTCFSCVECGKSLDGIPFTVDAMNQIHC 403 C VC K I R HP DG P HC Sbjct: 1298 NCYVCEKKI-PRTAEGLKYHEHPFWMETYCPSHDGDGTPKCCSCERLEHC 1346 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 36.7 bits (81), Expect = 0.035 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 2/72 (2%) Query: 292 FGICVKCGERISGENAGCTAMGNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADYYDT 351 F IC C I G + + +H CF C C+ + F N P+ +A Y + Sbjct: 169 FRICAGCNMEI-GHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYPFHKACYRER 227 Query: 352 LE-KCCVCRKII 362 KC VC I Sbjct: 228 YHPKCDVCSHFI 239 Score = 34.7 bits (76), Expect = 0.14 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 2/65 (3%) Query: 355 CCVCR-KIILDRILRATGKPYHPTCFSCVECGKSLDGIPFTVDAMNQIHCIDDFHKKFAP 413 C C +I R L +HP CF C C + + F+ H + +++ P Sbjct: 172 CAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYPFHKA-CYRERYHP 230 Query: 414 RCCVC 418 +C VC Sbjct: 231 KCDVC 235 >At5g66610.1 68418.m08396 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 529 Score = 35.9 bits (79), Expect = 0.061 Identities = 23/93 (24%), Positives = 33/93 (35%), Gaps = 3/93 (3%) Query: 294 ICVKCGERISGENAGCTAMGNTYHVHCFTCQRCN--VNLQGKPFYDVENEPYCEADYYDT 351 IC C I A+G +H CF C+ C+ + + + E YC D Sbjct: 200 ICDGCKSAIE-YGRSVHALGVNWHPECFCCRYCDKPIAMHEYKEHPFWKEKYCPFHEVDG 258 Query: 352 LEKCCVCRKIILDRILRATGKPYHPTCFSCVEC 384 KCC C ++ C C+EC Sbjct: 259 TPKCCSCERLEPWGTKYVMLADNRWLCVKCMEC 291 Score = 34.3 bits (75), Expect = 0.19 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 9/97 (9%) Query: 355 CCVCRKII-LDRILRATGKPYHPTCFSCVECGKSLDGIPFTVDAM-NQIHCIDDFHK-KF 411 C C+ I R + A G +HP CF C C K + + + +C FH+ Sbjct: 201 CDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPIAMHEYKEHPFWKEKYC--PFHEVDG 258 Query: 412 APRCCVCELPIMPEEGQEETVRVVALDRSFHVKCYRC 448 P+CC CE + G + ++A +R VKC C Sbjct: 259 TPKCCSCER--LEPWGTKYV--MLADNRWLCVKCMEC 291 >At3g61230.1 68416.m06852 LIM domain-containing protein similar to SP|P29675 Pollen specific protein SF3 {Helianthus annuus}; contains Pfam profile PF00412: LIM domain Length = 213 Score = 35.9 bits (79), Expect = 0.061 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 346 ADYYDTLEKCCVCRKII-LDRILRATGKPYHPTCFSCVECGKSL 388 A + T +KC C K + + ++ G PYH +CF C C +L Sbjct: 2 AAFTGTTDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTL 45 Score = 33.5 bits (73), Expect = 0.33 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 351 TLEKCCVCRKIILD-RILRATGKPYHPTCFSCVECG 385 T +KC C+K + + G+ YH TCF C G Sbjct: 103 TQDKCAACKKTVYPLEKMTMEGESYHKTCFRCAHSG 138 Score = 29.5 bits (63), Expect = 5.3 Identities = 12/39 (30%), Positives = 17/39 (43%) Query: 310 TAMGNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADY 348 T G YH CF C CN L + ++ YC+ + Sbjct: 25 TLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKTHF 63 >At2g40820.1 68415.m05038 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 903 Score = 35.9 bits (79), Expect = 0.061 Identities = 31/105 (29%), Positives = 41/105 (39%), Gaps = 5/105 (4%) Query: 146 HNLQYMTLPLPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLN 205 H+ P+ N + + Q Y P + P NS YMP P S N S + N N Sbjct: 739 HHSSMPNPPMTNTNPQMQQPYYPPPMQPPPPPMNSG-YMPTYIPKSVNDSSMPNPPMN-N 796 Query: 206 YNHDRT---CPPVYQNNFPEYNMSQAPTYESFYEPISPHPSSKTA 247 N PP Q P N PTY E ++ PSS ++ Sbjct: 797 TNPQMQQPYYPPPMQPAPPPMNSGYMPTYIPNSENVTNIPSSSSS 841 >At3g55770.1 68416.m06197 LIM domain-containing protein similar to pollen specific LIM domain protein 1b [Nicotiana tabacum] GI:6467905, PGPS/D1 [Petunia x hybrida] GI:4105772; contains Pfam profile PF00412: LIM domain Length = 199 Score = 35.1 bits (77), Expect = 0.11 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 351 TLEKCCVCRKIILD-RILRATGKPYHPTCFSCVECGKSL 388 T +KC C K + +L A G YH +CF C C L Sbjct: 6 TQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRL 44 Score = 31.5 bits (68), Expect = 1.3 Identities = 13/39 (33%), Positives = 18/39 (46%) Query: 310 TAMGNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADY 348 +A G YH CF C C LQ + +E YC+ + Sbjct: 24 SADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHF 62 >At2g45800.1 68415.m05696 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 226 Score = 35.1 bits (77), Expect = 0.11 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 351 TLEKCCVCRKII-LDRILRATGKPYHPTCFSCVECGKSL 388 TL+KC C K + + +L G YH +CF C C +L Sbjct: 6 TLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTL 44 Score = 33.9 bits (74), Expect = 0.25 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Query: 351 TLEKCCVCRKII--LDRILRATGKPYHPTCFSCVECG 385 T +KC C+K + L+++ G+ YH TCF C G Sbjct: 102 TQDKCATCKKTVYPLEKVTME-GESYHKTCFRCTHSG 137 Score = 33.1 bits (72), Expect = 0.43 Identities = 13/39 (33%), Positives = 18/39 (46%) Query: 310 TAMGNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADY 348 T GNTYH CF C C L + ++ YC+ + Sbjct: 24 TLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKPHF 62 >At2g32840.2 68415.m04021 proline-rich family protein Common family member: At1g04930 [Arabidopsis thaliana] Length = 291 Score = 34.7 bits (76), Expect = 0.14 Identities = 29/91 (31%), Positives = 39/91 (42%), Gaps = 4/91 (4%) Query: 154 PLPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHDRTCP 213 P PNPS V + S+SPVT + P P + RA A L+ +H Sbjct: 10 PNPNPSVSVAVSTPIVTASESPVTQPNTVITPSSQPQPQTPASSYRAIAPLHRHHPH--Q 67 Query: 214 PVYQNNFPEYNMSQAPTYESFYEPISPHPSS 244 +Y N P S + T S ++P P PSS Sbjct: 68 NIYTNPLP-IRRSNSVT-NSPHQPPHPDPSS 96 >At2g32840.1 68415.m04020 proline-rich family protein Common family member: At1g04930 [Arabidopsis thaliana] Length = 337 Score = 34.7 bits (76), Expect = 0.14 Identities = 29/91 (31%), Positives = 39/91 (42%), Gaps = 4/91 (4%) Query: 154 PLPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHDRTCP 213 P PNPS V + S+SPVT + P P + RA A L+ +H Sbjct: 10 PNPNPSVSVAVSTPIVTASESPVTQPNTVITPSSQPQPQTPASSYRAIAPLHRHHPH--Q 67 Query: 214 PVYQNNFPEYNMSQAPTYESFYEPISPHPSS 244 +Y N P S + T S ++P P PSS Sbjct: 68 NIYTNPLP-IRRSNSVT-NSPHQPPHPDPSS 96 >At2g39900.1 68415.m04904 LIM domain-containing protein similar to pollen specific LIM domain protein 1b [Nicotiana tabacum] GI:6467905, PGPS/D1 [Petunia x hybrida] GI:4105772; contains Pfam profile PF00412: LIM domain Length = 200 Score = 34.3 bits (75), Expect = 0.19 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Query: 351 TLEKCCVCRKIILD-RILRATGKPYHPTCFSCVECGKSL 388 T +KC C K + +L A G YH CF C C L Sbjct: 6 TQQKCRACEKTVYPVELLSADGISYHKACFKCSHCKSRL 44 Score = 32.3 bits (70), Expect = 0.75 Identities = 13/39 (33%), Positives = 18/39 (46%) Query: 310 TAMGNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADY 348 +A G +YH CF C C LQ + +E YC + Sbjct: 24 SADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHF 62 >At4g36860.1 68417.m05226 LIM domain-containing protein low similarity to LIM-domain protein [Branchiostoma floridae] GI:3360516, DRAL/Slim3/FHL2 [Homo sapiens] GI:7209525; contains Pfam profile PF00412: LIM domain Length = 351 Score = 33.5 bits (73), Expect = 0.33 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 312 MGNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADYYDTLE-KCCVCRKII 362 MG +H CF C C+ + F N PY + Y + KC VC I Sbjct: 1 MGGVWHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVCHNFI 52 Score = 32.7 bits (71), Expect = 0.57 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 371 GKPYHPTCFSCVECGKSLDGIPFTVDAMNQIHCIDDFHKKFAPRCCVC 418 G +HP CF C C K + F++ H + + ++ P+C VC Sbjct: 2 GGVWHPECFCCNACDKPIIDYEFSMSGNRPYHKL-CYKEQHHPKCDVC 48 >At5g66630.1 68418.m08398 LIM domain-containing protein contains low similarity to Pfam profile PF00412: LIM domain Length = 702 Score = 32.7 bits (71), Expect = 0.57 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 7/73 (9%) Query: 316 YHVHCFTCQRCNVNLQG-KPFYDVENEPYCEADYYDTLEKCCVCRKIILDRILRATGKPY 374 Y +C+ C+ + PF++ E YC D KCC C + L+ GK Sbjct: 402 YERYCYVCKEKKMKTYNIHPFWE---ERYCPVHEADGTPKCCSCER--LEPRGTKYGK-L 455 Query: 375 HPTCFSCVECGKS 387 + C+ECGKS Sbjct: 456 SDGRWLCLECGKS 468 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 31.9 bits (69), Expect = 0.99 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 2/94 (2%) Query: 183 YMPPPSPVSSNYSELARANANLNYNHDRTCPPVYQNNFPEYNMSQAPTYESFYEPISPHP 242 Y PPP P L ++ + Y N P + S APT P++ H Sbjct: 382 YGPPPGPPPMMRPPLPPGPPPSSFQDGQAMIRPYVPNKPSFVKSAAPTVVR--RPLAQHT 439 Query: 243 SSKTAMQENNLITKKEALSKRSPLPKEQEVDALT 276 T+M ++ ++E+ + P PK +L+ Sbjct: 440 PELTSMVPASVRVRRESATVTKPKPKTSIASSLS 473 >At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 489 Score = 31.5 bits (68), Expect = 1.3 Identities = 27/101 (26%), Positives = 42/101 (41%), Gaps = 11/101 (10%) Query: 153 LPLPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSS---NYSELARANANLNYNHD 209 +P P+P+S +Y + P Y P PSP SS YS+ A+A N+ Sbjct: 53 VPAPSPASSYGPQYSQEGYASQPNNPPPPTYAPAPSPASSYGHQYSQEGYASAASQPNYP 112 Query: 210 RTCPPVYQNNFPEYNMSQAPTYESFYEPISPHPSSKTAMQE 250 PP Q+ ++ ++ Y IS + SS + E Sbjct: 113 ---PPPSQS-----QVADRKKFDRRYSKISDNYSSLLQVSE 145 >At1g10200.1 68414.m01150 transcription factor LIM, putative strong similarity to transcription factor Ntlim1 [Nicotiana tabacum] GI:5689136, LIM domain protein WLIM-1 [Helianthus annuus] GI:5070280; contains Pfam profile PF00412: LIM domain Length = 190 Score = 31.5 bits (68), Expect = 1.3 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Query: 351 TLEKCCVCRKII--LDRILRATGKPYHPTCFSCVECGKSL 388 T +KC C K + +D+ L A + YH CF C C +L Sbjct: 6 TTQKCMACDKTVYLVDK-LTADNRVYHKACFRCHHCKGTL 44 Score = 29.1 bits (62), Expect = 7.0 Identities = 12/39 (30%), Positives = 15/39 (38%) Query: 310 TAMGNTYHVHCFTCQRCNVNLQGKPFYDVENEPYCEADY 348 TA YH CF C C L+ + E YC + Sbjct: 24 TADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF 62 >At5g24370.1 68418.m02873 invertase/pectin methylesterase inhibitor family protein contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 191 Score = 30.7 bits (66), Expect = 2.3 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Query: 252 NLITKKEALSKRSPLPKEQEVDALTNLLVQSITDSQDLDVFGIC-VKCGERISGENAGCT 310 N+ T E ++KR+ + V + + L+ + TD+QD VF C + +S + T Sbjct: 65 NIATITEVMTKRALTFATETVSQIQDYLLPNATDTQDKAVFSACEIAYKAVVSRLQSAYT 124 Query: 311 AMGNTYHV 318 +M N+ +V Sbjct: 125 SMKNSDYV 132 >At2g38410.1 68415.m04718 VHS domain-containing protein / GAT domain-containing protein weak similarity to hepatocyte growth factor-regulated tyrosine kinase substrate HRS isoform 2 [Homo sapiens] GI:9022389; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 671 Score = 30.7 bits (66), Expect = 2.3 Identities = 19/60 (31%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Query: 150 YMTLPLPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSP---VSSNYSELARANANLNY 206 Y L P P G Q + P T Y PP P S+N RANA+ +Y Sbjct: 521 YSQLQQPQPQQGYSQSQPQAQVQMQPSTRPQNPYEYPPPPWASTSANAYYTPRANASASY 580 >At1g77250.1 68414.m08997 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 522 Score = 30.7 bits (66), Expect = 2.3 Identities = 22/84 (26%), Positives = 33/84 (39%), Gaps = 7/84 (8%) Query: 284 TDSQDLDVFGICVKCGERISGENAGCTAMGNTYHVHCFT----CQRCNVNLQGKPFYDVE 339 TD++ +D C K S EN+ C +HV C+ C + Y Sbjct: 313 TDNRSVDTSTEC-KEDSNESEENSSCNMNHEVHHVEMSRDSELCRTCGTKVDSGGKYITC 371 Query: 340 NEPYCEADYYDTLEKCCVCRKIIL 363 + P+C YY +C R+I L Sbjct: 372 DHPFCPHKYYHI--RCLTSRQIKL 393 >At2g25380.1 68415.m03039 zinc finger protein-related very low similarity to SP|O95376 Ariadne-2 protein homolog (ARI-2) (Triad1 protein) {Homo sapiens}; contains Pfam profile PF01485: IBR (In Between Ring fingers) domain Length = 350 Score = 30.3 bits (65), Expect = 3.0 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 8/75 (10%) Query: 353 EKCCVC-RKIILDRILRATGKPYHPTCFSCVE--CGK--SLDGIPFTVDAMNQIHCIDDF 407 E C +C + + DR+ T K H CFSCV+ C K L I V + + + C D Sbjct: 198 ETCVICLEETVADRMF-FTDKCLHRYCFSCVKQTCVKCNGLFCIDCKVPSHSDLSCAD-- 254 Query: 408 HKKFAPRCCVCELPI 422 +KK P V ++ + Sbjct: 255 YKKLHPELLVDDIKL 269 >At5g66620.1 68418.m08397 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 644 Score = 29.9 bits (64), Expect = 4.0 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Query: 316 YHVHCFTCQRCNVNLQGK-PFYDVENEPYCEADYYDTLEKCCVCRKI 361 Y +C+ C+ + PF++ E YC D KCC C ++ Sbjct: 341 YERYCYVCKEKKMKTYNNHPFWE---ERYCPVHEADGTPKCCSCERL 384 >At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulose synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays Length = 1145 Score = 29.9 bits (64), Expect = 4.0 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 4/80 (5%) Query: 172 SKSPVTTNSEEYMP--PPSPVSSNYSELARANANLNYNHDRTCPPVYQNNFPEYNMSQAP 229 S+S ++ NS+ P PP+ S +++ + +NY+ D + +F Y + P Sbjct: 10 SRSNLSNNSDIQEPGRPPAGHSVKFAQRTSSGRYINYSRDDLDSELGGQDFMSYTVHIPP 69 Query: 230 TYESFYEPISPHPSSKTAMQ 249 T ++ +P+ P S K Q Sbjct: 70 TPDN--QPMDPSISQKVEEQ 87 >At3g45840.1 68416.m04961 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 633 Score = 29.9 bits (64), Expect = 4.0 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Query: 359 RKIILDR--ILRATGKPYHPTCFSCVECGKSLDGIPF-TVDAMNQIHC 403 R +I +R L A GK FSC CGK G + + D M +HC Sbjct: 366 RHLIYNRPFTLHARGKDLQIDWFSCDACGKQSTGFRYISDDLMLDVHC 413 >At2g21830.1 68415.m02594 DC1 domain-containing protein contains Pfam profilePF03107: DC1 domain Length = 569 Score = 29.9 bits (64), Expect = 4.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Query: 294 ICVKCGERISGENAGCTAMGNTYHVHCFTCQR 325 +C+ C ER+ G+ C YH+ C R Sbjct: 531 VCIICHERVLGKAVSCMECETIYHLRCIDRHR 562 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 29.9 bits (64), Expect = 4.0 Identities = 33/129 (25%), Positives = 49/129 (37%), Gaps = 13/129 (10%) Query: 154 PLPNPSSGVHQEYMMPVLSKSPV-----TTNSEEYMPPPSPVSSNYSELARANANLNYNH 208 P P P++G + +P LS S +T PP +P S S+ A A ++L + Sbjct: 424 PSPGPTAGF--TFNLPALSPSSPEMVSSSTGQSSLFPPSAPTSQVSSDQASATSSLT-DS 480 Query: 209 DRTCPPVYQNNFPEYNMSQAPTYESFYEPISPHPSSKTAMQENNLITKKEALSKRSPLPK 268 R ++ P A F P PSS + E KK S L Sbjct: 481 SRLFSSTSLSSTPPITPPDA-----FQSPQVSTPSSAVPITEPVSEPKKPEAQSSSILST 535 Query: 269 EQEVDALTN 277 + VD++ N Sbjct: 536 QSTVDSVAN 544 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.5 bits (63), Expect = 5.3 Identities = 24/91 (26%), Positives = 35/91 (38%), Gaps = 3/91 (3%) Query: 154 PLPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHDRTCP 213 P P P + P + SP + Y PPP P ++YS + YN P Sbjct: 737 PPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSP-PPSPPVYYYNSPPPPP 795 Query: 214 PVYQNNFPE--YNMSQAPTYESFYEPISPHP 242 V+ + P + SQ P + P+ P P Sbjct: 796 AVHYSPPPPPVIHHSQPPPPPIYEGPLPPIP 826 >At3g60300.1 68416.m06740 RWD domain-containing protein contains weak similarity to RING finger protein 25 (RING finger protein AO7) (Swiss-Prot:Q9QZR0) [Mus musculus] Length = 366 Score = 29.5 bits (63), Expect = 5.3 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Query: 415 CCVCELPIMPEEGQEETVRVVALDRSFHVKCYRCE 449 C +C P+ PE+G + + + L FH C+ CE Sbjct: 121 CPLCLYPLFPEDGGSKQMPFMKLMSCFH--CFHCE 153 >At3g42670.1 68416.m04437 SNF2 domain-containing protein / helicase domain-containing protein low similarity to SP|P41410 DNA repair protein rhp54 (RAD54 homolog) {Schizosaccharomyces pombe}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1256 Score = 29.5 bits (63), Expect = 5.3 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 4/74 (5%) Query: 150 YMTLPLPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHD 209 ++TL + S H++YM VL +SP +E P S S L + + +L Sbjct: 819 FLTL-MREDSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLS 877 Query: 210 RTCPPVYQNNFPEY 223 T ++QNNF EY Sbjct: 878 GT---LFQNNFCEY 888 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 29.5 bits (63), Expect = 5.3 Identities = 24/101 (23%), Positives = 41/101 (40%), Gaps = 3/101 (2%) Query: 169 PVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHDRTCPPVYQNNFPEYNMSQA 228 P+ +P ++S P P SS+ +++N N N + PPV N PE + + Sbjct: 83 PITLPNPPDSSSNPNSNPNPPESSSNPNPPDSSSNPNSNPN---PPVTVPNPPESSSNPN 139 Query: 229 PTYESFYEPISPHPSSKTAMQENNLITKKEALSKRSPLPKE 269 P S +P+P ++ + S +P P E Sbjct: 140 PPDSSSNPNSNPNPPESSSNPNPPVTVPNPPESSSNPNPPE 180 >At1g68880.1 68414.m07883 bZIP transcription factor family protein similar to common plant regulatory factor 6 GI:9650826 from [Petroselinum crispum]; contains Pfam profile: PF00170 bZIP transcription factor Length = 138 Score = 29.5 bits (63), Expect = 5.3 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 13/100 (13%) Query: 219 NFPEYNMSQAPTYESFYE--PISPHP-----SSKTA----MQENNLITKKEALSKRSPLP 267 N P N + ++ F + P+S P SS+TA + ++ +E+ ++RS + Sbjct: 7 NLPSQNPNPQSLFQIFVDRVPLSNLPATSDDSSRTAEDNERKRRRKVSNRES-ARRSRMR 65 Query: 268 KEQEVDALTNLLVQSITDSQDL-DVFGICVKCGERISGEN 306 K++ ++ L ++LVQ I ++ L D +C E++ EN Sbjct: 66 KQRHMEELWSMLVQLINKNKSLVDELSQARECYEKVIEEN 105 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 29.1 bits (62), Expect = 7.0 Identities = 24/91 (26%), Positives = 30/91 (32%), Gaps = 4/91 (4%) Query: 151 MTLP-LPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHD 209 + LP LPN S + Y P P T Y PPP S + Y Sbjct: 281 LQLPQLPNQFSPQQEPYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQ 340 Query: 210 RTCPPVYQNNFPEYNMSQAPTYESFYEPISP 240 PP + YN + P + Y P P Sbjct: 341 ---PPPQLQHPSGYNPEEPPYPQQSYPPNPP 368 >At4g38870.1 68417.m05504 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 426 Score = 29.1 bits (62), Expect = 7.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 296 VKCGERISGENAGCTAMGNTYHVHCFTCQRCNVN 329 +K IS ++ +A TYHV C+T QR ++ Sbjct: 122 LKSTREISSSSSSSSASSITYHVTCYTQQRMTIS 155 >At3g62670.1 68416.m07040 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 426 Score = 29.1 bits (62), Expect = 7.0 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 163 HQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHDRTCPPVYQNNFPE 222 HQ+Y + S S + T E P S + N L N+NL + D PP N F + Sbjct: 364 HQQYQSTLNSISAMLTKQESRHVPSSAME-NSEPLMIYNSNLPFGIDECFPPAGFNIFDQ 422 >At3g57480.1 68416.m06399 zinc finger (C2H2 type, AN1-like) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type; contains Pfam domain, PF01428: AN1-like Zinc finger Length = 249 Score = 29.1 bits (62), Expect = 7.0 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 382 VECGKSLDGIPFTVDAMNQIHCIDDFHKKFAPRCC 416 V+ K +D +PFT D Q++C+D H+ + C Sbjct: 15 VDYCKQIDFLPFTCDRCLQVYCLD--HRSYMKHDC 47 >At2g41835.1 68415.m05170 zinc finger (C2H2 type, AN1-like) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type; contains Pfam domain, PF01428: AN1-like Zinc finger Length = 279 Score = 29.1 bits (62), Expect = 7.0 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Query: 382 VECGKSLDGIPFTVDAMNQIHCIDDFHKKFAPRCC 416 V+ K +D +PFT D Q+ C+D H+ + C Sbjct: 15 VDVCKQIDFLPFTCDRCLQVFCLD--HRSYMKHSC 47 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 28.7 bits (61), Expect = 9.3 Identities = 26/123 (21%), Positives = 45/123 (36%) Query: 154 PLPNPSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHDRTCP 213 P P S H P S + ++S + P SP + A A ++ + P Sbjct: 214 PSPVSHSPSHSPAHTPSHSPAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAHSPSHSP 273 Query: 214 PVYQNNFPEYNMSQAPTYESFYEPISPHPSSKTAMQENNLITKKEALSKRSPLPKEQEVD 273 ++ P + +Q+P S P SP P S + ++ + + SP D Sbjct: 274 ATPKSPSPSSSPAQSPATPSPMTPQSPSPVSSPSPDQSAAPSDQSTPLAPSPSETTPTAD 333 Query: 274 ALT 276 +T Sbjct: 334 NIT 336 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 28.7 bits (61), Expect = 9.3 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 5/72 (6%) Query: 172 SKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHDRTCPPVYQNNFPEY---NMSQA 228 S SP + + P SP S +YS + A + + + T P Y P Y + S + Sbjct: 1614 SYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPT-SPAYSPTSPSYSPTSPSYS 1672 Query: 229 PTYESFYEPISP 240 PT S Y P SP Sbjct: 1673 PTSPS-YSPTSP 1683 >At3g48980.1 68416.m05350 expressed protein Length = 539 Score = 28.7 bits (61), Expect = 9.3 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 158 PSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELAR 199 P G +++MM L K P T MPPP +S YS L R Sbjct: 475 PRDGNERKFMMESLVKRPAETGPCA-MPPPYDPASFYSVLKR 515 >At3g13840.1 68416.m01747 scarecrow transcription factor family protein Length = 510 Score = 28.7 bits (61), Expect = 9.3 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Query: 222 EYNMSQAPTYESFYEPISPHPSSKTAMQENNLITKKEALSKRSPLPKEQEVDALTNLLVQ 281 ++++S + SF+ P+ S++ M + L+ E +S LP A+ +L Q Sbjct: 194 QHHLSSSSVSSSFW-PVFTFASAEVKMFQKTLLKFYE-VSPWFALPNNMANSAILQILAQ 251 Query: 282 SITDSQDLDVFGICVKCG 299 D +DL + I V G Sbjct: 252 DPKDKKDLHIIDIGVSHG 269 >At2g20240.1 68415.m02365 expressed protein Length = 713 Score = 28.7 bits (61), Expect = 9.3 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 9/84 (10%) Query: 220 FPEYNMSQAPTYESFYEPISPHPSSK--TAMQENNLITKKEALSK--RSPLPKEQE---V 272 F + + S P + S ++P+ PHP +K T ++ + + ++ L++ + P QE + Sbjct: 144 FLQESNSLFPQHLSDFQPVPPHPDAKRITVLRPSKAVGVQKCLAEDSKKPASLNQETGWI 203 Query: 273 DAL--TNLLVQSITDSQDLDVFGI 294 DA+ T ++V + + LD+ I Sbjct: 204 DAVQPTRIVVLKPSPGKSLDIKAI 227 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 28.7 bits (61), Expect = 9.3 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Query: 158 PSSGVHQEYMMPVLSKSPVTTNSEEYMPPPSPVSSNYSELARANANLNYNHDRTCPP 214 P ++Q Y P P N PPPS + NY + N++ N++ PP Sbjct: 269 PPPNMNQSYQGP----PPPNMNQSYQGPPPSNMGQNYRGPSLPPPNMSQNYEGPPPP 321 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.132 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,191,040 Number of Sequences: 28952 Number of extensions: 501470 Number of successful extensions: 1682 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 27 Number of HSP's that attempted gapping in prelim test: 1609 Number of HSP's gapped (non-prelim): 98 length of query: 492 length of database: 12,070,560 effective HSP length: 84 effective length of query: 408 effective length of database: 9,638,592 effective search space: 3932545536 effective search space used: 3932545536 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -