BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001881-TA|BGIBMGA001881-PA|IPR013621|Ion transport N-terminal (90 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30C2.02 |mmd1||deoxyhypusine hydroxylase |Schizosaccharomyce... 27 0.32 SPAC30D11.14c |||RNA-binding protein |Schizosaccharomyces pombe|... 25 1.7 SPAC16E8.10c |||mitochondrial ribosomal protein subunit S7|Schiz... 23 7.0 SPBC23G7.06c |||conserved eukaryotic protein|Schizosaccharomyces... 23 7.0 SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21... 23 9.2 SPAC22F3.10c |gcs1|apd1|glutamate-cysteine ligase Gcs1 |Schizosa... 23 9.2 SPBC18H10.02 |lcf1||long-chain-fatty-acid-CoA ligase Lcf1 |Schiz... 23 9.2 >SPAC30C2.02 |mmd1||deoxyhypusine hydroxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 318 Score = 27.5 bits (58), Expect = 0.32 Identities = 10/18 (55%), Positives = 14/18 (77%) Query: 21 SLYGTPVEPAPPAPDAKQ 38 S+Y + V+PAPP PD +Q Sbjct: 155 SMYDSVVDPAPPMPDHEQ 172 >SPAC30D11.14c |||RNA-binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 534 Score = 25.0 bits (52), Expect = 1.7 Identities = 11/33 (33%), Positives = 15/33 (45%) Query: 7 SGTGKVHFGGLDDVSLYGTPVEPAPPAPDAKQG 39 S T H G+ + P PAPP P + +G Sbjct: 111 SRTSYDHSEGITSTTSASPPSAPAPPLPPSSEG 143 >SPAC16E8.10c |||mitochondrial ribosomal protein subunit S7|Schizosaccharomyces pombe|chr 1|||Manual Length = 259 Score = 23.0 bits (47), Expect = 7.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 68 MKERIRQKAAGHWVIHPCSS 87 +KER R++ A W++ C S Sbjct: 194 LKERQRRRIALQWILGECKS 213 >SPBC23G7.06c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 745 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Query: 15 GGLDDVSLYGTPVEPAPPAPDAK 37 GGL D+ L+ P P DAK Sbjct: 404 GGLWDIELFRAPTIQKPAEKDAK 426 >SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 22.6 bits (46), Expect = 9.2 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 15 GGLDD-VSLYGTPVEPAPPAPDAKQGFLR 42 G +D +S+ G + P PD KQ F R Sbjct: 297 GDIDKLISIKGLVLRCTPVIPDMKQAFFR 325 >SPAC22F3.10c |gcs1|apd1|glutamate-cysteine ligase Gcs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 669 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/34 (26%), Positives = 14/34 (41%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPPAPD 35 S+ Q + HF L+ + +P PP D Sbjct: 443 SILQDNSVSNAHFENLNSTNWQSMRFKPPPPGSD 476 >SPBC18H10.02 |lcf1||long-chain-fatty-acid-CoA ligase Lcf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 22.6 bits (46), Expect = 9.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 19 DVSLYGTPVEPAPPAPD 35 D PVEP PP+P+ Sbjct: 223 DFEKMSPPVEPDPPSPE 239 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.135 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 406,829 Number of Sequences: 5004 Number of extensions: 13570 Number of successful extensions: 32 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 7 length of query: 90 length of database: 2,362,478 effective HSP length: 61 effective length of query: 29 effective length of database: 2,057,234 effective search space: 59659786 effective search space used: 59659786 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -