BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001881-TA|BGIBMGA001881-PA|IPR013621|Ion transport N-terminal (90 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 1.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 19 6.2 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 19 6.2 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 19 6.2 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 19 6.2 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 19 6.2 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 19 6.2 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 19 6.2 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 19 6.2 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 19 6.2 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 19 8.2 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 19 8.2 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 19 8.2 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 19 8.2 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 1.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 15 GGLDDVSLYGTPVEPAPPAPDAKQGF 40 GG + + PV PA PD++ G+ Sbjct: 127 GGANLTNSLTGPVRPAACTPDSRVGY 152 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 98 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 128 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 98 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 128 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 98 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 128 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 98 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 128 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 98 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 128 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 54 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 84 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 98 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 128 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 98 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 128 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 19.4 bits (38), Expect = 6.2 Identities = 9/31 (29%), Positives = 10/31 (32%) Query: 2 SLKQGSGTGKVHFGGLDDVSLYGTPVEPAPP 32 S K T D+S G P PP Sbjct: 98 SCKYADSTSSTGVASPQDLSTNGAPPRSTPP 128 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 19.0 bits (37), Expect = 8.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 22 LYGTPVEPAPPAPD 35 LYG+ V PPA D Sbjct: 255 LYGSVVIRQPPAKD 268 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 19.0 bits (37), Expect = 8.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 22 LYGTPVEPAPPAPD 35 LYG+ V PPA D Sbjct: 255 LYGSVVIRQPPAKD 268 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 19.0 bits (37), Expect = 8.2 Identities = 9/27 (33%), Positives = 12/27 (44%) Query: 13 HFGGLDDVSLYGTPVEPAPPAPDAKQG 39 H+G V G V+P P + D G Sbjct: 29 HYGAAVQVPQGGGAVQPDPGSCDPSVG 55 Score = 19.0 bits (37), Expect = 8.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 15 GGLDDVSLYGTP 26 GG DD+S G+P Sbjct: 311 GGGDDISPQGSP 322 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 19.0 bits (37), Expect = 8.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 15 GGLDDVSLYGTP 26 GG DD+S G+P Sbjct: 313 GGGDDISPQGSP 324 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.135 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,794 Number of Sequences: 317 Number of extensions: 680 Number of successful extensions: 15 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of query: 90 length of database: 114,650 effective HSP length: 47 effective length of query: 43 effective length of database: 99,751 effective search space: 4289293 effective search space used: 4289293 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -