GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001881-TA|BGIBMGA001881-PA|IPR013621|Ion transport
N-terminal
         (90 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein ...    24   0.73 
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    23   2.2  
AY146744-1|AAO12104.1|  176|Anopheles gambiae odorant-binding pr...    21   9.0  

>AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein
           protein.
          Length = 596

 Score = 24.2 bits (50), Expect = 0.73
 Identities = 12/33 (36%), Positives = 17/33 (51%)

Query: 6   GSGTGKVHFGGLDDVSLYGTPVEPAPPAPDAKQ 38
           GS  G   FGG D    YG+ V+  P A + ++
Sbjct: 561 GSYMGSSQFGGKDIRDSYGSRVDAQPVALEPEE 593


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 22.6 bits (46), Expect = 2.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)

Query: 24  GTPVEPAPPAP 34
           GTP +P PP P
Sbjct: 204 GTPTQPQPPRP 214


>AY146744-1|AAO12104.1|  176|Anopheles gambiae odorant-binding
           protein AgamOBP8 protein.
          Length = 176

 Score = 20.6 bits (41), Expect = 9.0
 Identities = 8/12 (66%), Positives = 9/12 (75%)

Query: 31  PPAPDAKQGFLR 42
           PPAPD+  G LR
Sbjct: 149 PPAPDSGGGCLR 160


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.135    0.413 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,759
Number of Sequences: 2123
Number of extensions: 2979
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 90
length of database: 516,269
effective HSP length: 54
effective length of query: 36
effective length of database: 401,627
effective search space: 14458572
effective search space used: 14458572
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 41 (20.6 bits)