SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001880-TA|BGIBMGA001880-PA|undefined
         (106 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   3.1  

>SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2033

 Score = 27.1 bits (57), Expect = 3.1
 Identities = 12/45 (26%), Positives = 22/45 (48%)

Query: 1    MRATLQRLAGLLPELDRYLSNYGIKANFTYSRDKLDADMKRYSKL 45
            ++ T+ +L+   PEL RY+    I      SR ++ + M  Y  +
Sbjct: 1634 VKPTMAKLSSSAPELQRYICKVNIFLRTKNSRSRMKSGMLAYRSM 1678


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.317    0.133    0.367 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,604,317
Number of Sequences: 59808
Number of extensions: 62028
Number of successful extensions: 149
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 148
Number of HSP's gapped (non-prelim): 1
length of query: 106
length of database: 16,821,457
effective HSP length: 72
effective length of query: 34
effective length of database: 12,515,281
effective search space: 425519554
effective search space used: 425519554
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -