BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001880-TA|BGIBMGA001880-PA|undefined (106 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 >SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2033 Score = 27.1 bits (57), Expect = 3.1 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 1 MRATLQRLAGLLPELDRYLSNYGIKANFTYSRDKLDADMKRYSKL 45 ++ T+ +L+ PEL RY+ I SR ++ + M Y + Sbjct: 1634 VKPTMAKLSSSAPELQRYICKVNIFLRTKNSRSRMKSGMLAYRSM 1678 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,604,317 Number of Sequences: 59808 Number of extensions: 62028 Number of successful extensions: 149 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 148 Number of HSP's gapped (non-prelim): 1 length of query: 106 length of database: 16,821,457 effective HSP length: 72 effective length of query: 34 effective length of database: 12,515,281 effective search space: 425519554 effective search space used: 425519554 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -