BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001879-TA|BGIBMGA001879-PA|undefined (266 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 24 1.0 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 2.4 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Query: 131 DEDLDMMQWPPVPKPDDHLPVNKESPERASPPLYEVE 167 DE L ++ PP PKP V++ P P E E Sbjct: 241 DEQLKELENPPTPKPRP-TKVSRRKPRPPRPTQVEEE 276 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 143 PKPDDHLPVNKESPERASPPLYE 165 P+PD +PV E ASP + E Sbjct: 80 PEPDPEIPVAPEPAPLASPLVQE 102 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,450 Number of Sequences: 317 Number of extensions: 2109 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 266 length of database: 114,650 effective HSP length: 56 effective length of query: 210 effective length of database: 96,898 effective search space: 20348580 effective search space used: 20348580 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -