BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001879-TA|BGIBMGA001879-PA|undefined (266 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 3.9 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.0 bits (52), Expect = 2.3 Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 100 GELASAFSDYHTVINNRHKLKVIPVLHCDED 130 G + S YH + NN +++ + C +D Sbjct: 2991 GNMTSILPSYHNITNNNSVMRLEYCIDCSQD 3021 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 3.9 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Query: 143 PKPDDHLPVNKESPERASPPLYEVELTASDEDEDTSVLELV 183 P PD P+N + PL ++ DEDE +VL+ + Sbjct: 2342 PSPD---PLNIAELVKEPKPLKAIDFCYHDEDEMVTVLDCI 2379 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,424 Number of Sequences: 2123 Number of extensions: 8977 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 266 length of database: 516,269 effective HSP length: 63 effective length of query: 203 effective length of database: 382,520 effective search space: 77651560 effective search space used: 77651560 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -