BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001878-TA|BGIBMGA001878-PA|undefined (503 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 25 1.5 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 25 1.9 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 7.8 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 25.0 bits (52), Expect = 1.5 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 71 FEEADNDVADSVLSFVSAFPDMQVLVVCERSPYPPIELPPTNSSYRNVKILSLDYE 126 FE V+D+V++F AF DM +C+ P + PT + + +D+E Sbjct: 467 FENQLQFVSDAVMAFAYAFRDMH-KELCDGKPGLCDAMKPTKGTELLKYLRKVDFE 521 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 24.6 bits (51), Expect = 1.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Query: 76 NDVADSVLSFVSAFPDMQVLVVCERSPYPPIELPPTNSSYRNVKI 120 ++ + V +SA M V ++ R PP E P S Y V I Sbjct: 239 SESGEKVTLGISALLSMTVFLMTIRESLPPTEKTPLISLYYGVSI 283 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.6 bits (46), Expect = 7.8 Identities = 11/29 (37%), Positives = 14/29 (48%) Query: 62 SLVTVVFRQFEEADNDVADSVLSFVSAFP 90 +L T +FR D+ V SF AFP Sbjct: 268 NLETSLFRPLSSEATDLRMGVASFCKAFP 296 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.137 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,967 Number of Sequences: 429 Number of extensions: 6900 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 503 length of database: 140,377 effective HSP length: 61 effective length of query: 442 effective length of database: 114,208 effective search space: 50479936 effective search space used: 50479936 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -