BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001878-TA|BGIBMGA001878-PA|undefined (503 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 27 0.40 AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochr... 27 0.40 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 26 0.70 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 2.1 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 2.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 2.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 2.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 2.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 2.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 2.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 2.1 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 24 2.8 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 24 2.8 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 23 3.8 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 23 3.8 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 8.7 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 26.6 bits (56), Expect = 0.40 Identities = 20/86 (23%), Positives = 33/86 (38%), Gaps = 4/86 (4%) Query: 281 EQRSTFYKKYKMKIVVGEDGTVHEY-GCAKDTPRCFPTVKGKPSYVYSDKHTPPC--CLR 337 EQ +T Y + ++ + + Y C D C P + V D C C Sbjct: 17 EQYTTKYDNINVDEILASERLLKNYFNCIMDRGACTPDAD-ELKRVLPDALKSDCAKCSE 75 Query: 338 NMREVTKHVLDVLEQAGVRCWLETSS 363 +E+TK V+ L + W E ++ Sbjct: 76 KQKEMTKKVIHFLSHNKQQMWKELTA 101 >AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q6 protein. Length = 125 Score = 26.6 bits (56), Expect = 0.40 Identities = 18/64 (28%), Positives = 27/64 (42%) Query: 265 VLKTLPEKQIVAEKVKEQRSTFYKKYKMKIVVGEDGTVHEYGCAKDTPRCFPTVKGKPSY 324 +L TL Q + KV+E+ + K K+ + C K+T R FP+V Y Sbjct: 8 ILLTLANLQDIQTKVREEILSVVGKEKIPTYNDLQELKYTKRCIKETLRLFPSVPFISRY 67 Query: 325 VYSD 328 D Sbjct: 68 ASED 71 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 25.8 bits (54), Expect = 0.70 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Query: 88 AFPDMQVL-VVCERSPYPPIELPPTNSSYRNVKILSLDYEIDSCPYT 133 AF VL V +P P ++P N + I+S DY P T Sbjct: 166 AFGSKYVLSVTVSANPLPSYDIPEINKVVDFINIMSYDYHTADQPQT 212 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 298 EDGTVHEYGCAKDTPRCFPTVKGK 321 + T H GC +P CF +GK Sbjct: 214 QKATEHVIGCVLCSPGCFSLFRGK 237 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 298 EDGTVHEYGCAKDTPRCFPTVKGK 321 + T H GC +P CF +GK Sbjct: 528 QKATEHVIGCVLCSPGCFSLFRGK 551 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 298 EDGTVHEYGCAKDTPRCFPTVKGK 321 + T H GC +P CF +GK Sbjct: 788 QKATEHVIGCVLCSPGCFSLFRGK 811 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 298 EDGTVHEYGCAKDTPRCFPTVKGK 321 + T H GC +P CF +GK Sbjct: 788 QKATEHVIGCVLCSPGCFSLFRGK 811 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 298 EDGTVHEYGCAKDTPRCFPTVKGK 321 + T H GC +P CF +GK Sbjct: 761 QKATEHVIGCVLCSPGCFSLFRGK 784 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 298 EDGTVHEYGCAKDTPRCFPTVKGK 321 + T H GC +P CF +GK Sbjct: 761 QKATEHVIGCVLCSPGCFSLFRGK 784 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 298 EDGTVHEYGCAKDTPRCFPTVKGK 321 + T H GC +P CF +GK Sbjct: 788 QKATEHVIGCVLCSPGCFSLFRGK 811 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Query: 298 EDGTVHEYGCAKDTPRCFPTVKGK 321 + T H GC +P CF +GK Sbjct: 788 QKATEHVIGCVLCSPGCFSLFRGK 811 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.8 bits (49), Expect = 2.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Query: 129 SCPYTSSPLSPFNIETEYTLFVPDS 153 S S+PL FNI T L+ P S Sbjct: 18 SSALNSTPLIEFNISTSNYLYTPSS 42 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.8 bits (49), Expect = 2.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Query: 129 SCPYTSSPLSPFNIETEYTLFVPDS 153 S S+PL FNI T L+ P S Sbjct: 18 SSALNSTPLIEFNISTSNYLYTPSS 42 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 23.4 bits (48), Expect = 3.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 401 DADGFVWERATKGHYYS 417 D D F+ ER + HYYS Sbjct: 109 DPDNFLPERCQQRHYYS 125 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 23.4 bits (48), Expect = 3.8 Identities = 9/17 (52%), Positives = 10/17 (58%) Query: 401 DADGFVWERATKGHYYS 417 D D F+ ER HYYS Sbjct: 109 DPDNFLPERTANRHYYS 125 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.2 bits (45), Expect = 8.7 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Query: 253 QVLYHTFG-PGRKVLKTLPEKQIVAEKVKEQRSTFYKKYKMKIV 295 Q L FG G + PE + +K++ + S+F+ K K KIV Sbjct: 132 QALVKNFGFDGLDLAWEFPETK--PKKIRGKISSFFSKLKHKIV 173 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.137 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,519 Number of Sequences: 317 Number of extensions: 5469 Number of successful extensions: 22 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 16 length of query: 503 length of database: 114,650 effective HSP length: 60 effective length of query: 443 effective length of database: 95,630 effective search space: 42364090 effective search space used: 42364090 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -