SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001877-TA|BGIBMGA001877-PA|undefined
         (859 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    23   8.8  

>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 68  SHGRVVFILVDALRYDFTEYDDKLEKPLPYQNRLPVMQRT 107
           S G   + L++A+R +   Y  KLE   PY+  +   Q T
Sbjct: 867 SCGSGKYPLINAMRQELEGYKVKLEYDGPYETSISSGQYT 906


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.324    0.137    0.424 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 185,599
Number of Sequences: 317
Number of extensions: 7659
Number of successful extensions: 18
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 17
Number of HSP's gapped (non-prelim): 1
length of query: 859
length of database: 114,650
effective HSP length: 63
effective length of query: 796
effective length of database: 94,679
effective search space: 75364484
effective search space used: 75364484
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 47 (23.0 bits)

- SilkBase 1999-2023 -