BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001877-TA|BGIBMGA001877-PA|undefined
(859 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 8.8
>DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7
protein.
Length = 980
Score = 23.0 bits (47), Expect = 8.8
Identities = 13/40 (32%), Positives = 20/40 (50%)
Query: 68 SHGRVVFILVDALRYDFTEYDDKLEKPLPYQNRLPVMQRT 107
S G + L++A+R + Y KLE PY+ + Q T
Sbjct: 867 SCGSGKYPLINAMRQELEGYKVKLEYDGPYETSISSGQYT 906
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.324 0.137 0.424
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 185,599
Number of Sequences: 317
Number of extensions: 7659
Number of successful extensions: 18
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 17
Number of HSP's gapped (non-prelim): 1
length of query: 859
length of database: 114,650
effective HSP length: 63
effective length of query: 796
effective length of database: 94,679
effective search space: 75364484
effective search space used: 75364484
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 47 (23.0 bits)
- SilkBase 1999-2023 -