BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001875-TA|BGIBMGA001875-PA|undefined (687 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 23 5.3 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 23 5.3 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 23 9.2 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 9.2 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 23.4 bits (48), Expect = 5.3 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 451 EHLHKNPMDNWYKGKLKYE 469 +HL+KN D W + + KY+ Sbjct: 90 QHLYKNKQDWWKQLEAKYD 108 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 23.4 bits (48), Expect = 5.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 50 ERENCKTETLIDSIKSEI 67 ERENC + + D++K E+ Sbjct: 171 ERENCHLKFVTDTLKKEL 188 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 9.2 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 547 TNRKSEIDERLSSLAAGSAEDMLEAMRRVW 576 T + EI ERLS+L + E + +W Sbjct: 239 TTNEKEIFERLSALPVDKLLQISEKVANIW 268 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 9.2 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 547 TNRKSEIDERLSSLAAGSAEDMLEAMRRVW 576 T + EI ERLS+L + E + +W Sbjct: 241 TTNEKEIFERLSALPVDKLLQISEEVANIW 270 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.134 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,056 Number of Sequences: 317 Number of extensions: 7125 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 4 length of query: 687 length of database: 114,650 effective HSP length: 61 effective length of query: 626 effective length of database: 95,313 effective search space: 59665938 effective search space used: 59665938 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -