BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001873-TA|BGIBMGA001873-PA|IPR011032|GroES-like (84 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2E1P3.01 |||zinc binding dehydrogenase|Schizosaccharomyces p... 25 1.9 SPCC13B11.01 |adh1|adh|alcohol dehydrogenase Adh1|Schizosaccharo... 24 2.5 SPCC737.07c |||DNA polymerase alpha-associated DNA helicase A |S... 23 5.8 >SPAC2E1P3.01 |||zinc binding dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 24.6 bits (51), Expect = 1.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 48 MRAVVLTGFGGLKTVKILKKPEPTVGE 74 M+AV+ G G++ + KP P GE Sbjct: 1 MKAVIADGQNGVEVISDAPKPTPEKGE 27 >SPCC13B11.01 |adh1|adh|alcohol dehydrogenase Adh1|Schizosaccharomyces pombe|chr 3|||Manual Length = 350 Score = 24.2 bits (50), Expect = 2.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 50 AVVLTGFGGLKTVKILKKPEPTVGEGEVLIRVK 82 A V GG + VK + P G+ EVL+ +K Sbjct: 9 AAVFHTHGGPENVKFEEVPVAEPGQDEVLVNIK 41 >SPCC737.07c |||DNA polymerase alpha-associated DNA helicase A |Schizosaccharomyces pombe|chr 3|||Manual Length = 660 Score = 23.0 bits (47), Expect = 5.8 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Query: 51 VVLTGFGGLKTVKILKKPEPTVGEGEVL 78 VV TGFGG KT+ +K +P GE L Sbjct: 63 VVKTGFGG-KTIIDFEK-DPAFSNGEEL 88 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.314 0.135 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,963 Number of Sequences: 5004 Number of extensions: 2933 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 3 length of query: 84 length of database: 2,362,478 effective HSP length: 60 effective length of query: 24 effective length of database: 2,062,238 effective search space: 49493712 effective search space used: 49493712 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -