BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001873-TA|BGIBMGA001873-PA|IPR011032|GroES-like (84 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15549| Best HMM Match : ADH_zinc_N (HMM E-Value=9.4e-13) 36 0.005 SB_27978| Best HMM Match : HycH (HMM E-Value=0.12) 27 2.2 >SB_15549| Best HMM Match : ADH_zinc_N (HMM E-Value=9.4e-13) Length = 562 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/36 (44%), Positives = 24/36 (66%) Query: 48 MRAVVLTGFGGLKTVKILKKPEPTVGEGEVLIRVKA 83 MR+VVLTG GG +K+ K P +G+V+++V A Sbjct: 39 MRSVVLTGHGGNNKIKVEKYARPKPMQGQVVVKVHA 74 >SB_27978| Best HMM Match : HycH (HMM E-Value=0.12) Length = 316 Score = 27.1 bits (57), Expect = 2.2 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 48 MRAVVLTGFGGLKTVKILKKPEPTVGEGEVLIRV 81 M+AV+ T GG +++ I P P + E EVLIRV Sbjct: 28 MKAVLFTP-GGPESMYIGDAPRPKLKETEVLIRV 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.314 0.135 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,306,063 Number of Sequences: 59808 Number of extensions: 22530 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 2 length of query: 84 length of database: 16,821,457 effective HSP length: 61 effective length of query: 23 effective length of database: 13,173,169 effective search space: 302982887 effective search space used: 302982887 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -