BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001871-TA|BGIBMGA001871-PA|undefined (234 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35890| Best HMM Match : DUF1325 (HMM E-Value=0.0011) 52 4e-07 >SB_35890| Best HMM Match : DUF1325 (HMM E-Value=0.0011) Length = 152 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/36 (61%), Positives = 27/36 (75%) Query: 197 DPYEVLFEDSSYADGYSPPERVAQRYVIAIKEGKGR 232 D Y V FED+SYADG++PP V QRYV+ +KE K R Sbjct: 117 DHYSVSFEDTSYADGFAPPLHVPQRYVVVVKETKRR 152 Score = 37.1 bits (82), Expect = 0.012 Identities = 13/19 (68%), Positives = 17/19 (89%) Query: 142 PPLCGAVPADAGHVARPGD 160 PPLCGAVPA+ ++A+PGD Sbjct: 95 PPLCGAVPAEPNYIAQPGD 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,973,773 Number of Sequences: 59808 Number of extensions: 199429 Number of successful extensions: 422 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 420 Number of HSP's gapped (non-prelim): 2 length of query: 234 length of database: 16,821,457 effective HSP length: 80 effective length of query: 154 effective length of database: 12,036,817 effective search space: 1853669818 effective search space used: 1853669818 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -