BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001871-TA|BGIBMGA001871-PA|undefined (234 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 4.7 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 6.2 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 21 6.2 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.8 bits (44), Expect = 4.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Query: 119 LMKLLLSAAQTLPLHVGRAGERAPPLCGAVPADAGH 154 L KL LSA LP G APPL A H Sbjct: 178 LEKLRLSARPLLPPSFGIFPGGAPPLVSPFLAAMAH 213 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 6.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 181 TCFYRAVVNRLPASAADPYEVLFEDSSYADGY 212 TC ++++N S ++ Y D SYA Y Sbjct: 267 TCVNKSMLNSHMKSHSNVYRYSCRDCSYATKY 298 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 6.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Query: 181 TCFYRAVVNRLPASAADPYEVLFEDSSYADGY 212 TC ++++N S ++ Y D SYA Y Sbjct: 25 TCVNKSMLNSHMKSHSNVYRYSCRDCSYATKY 56 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,283 Number of Sequences: 317 Number of extensions: 1312 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 234 length of database: 114,650 effective HSP length: 55 effective length of query: 179 effective length of database: 97,215 effective search space: 17401485 effective search space used: 17401485 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -