BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001871-TA|BGIBMGA001871-PA|undefined (234 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.13c |||DUF726 family protein|Schizosaccharomyces pombe|c... 27 3.1 SPBC2G2.06c |apl1||AP-2 adaptor complex subunit Apl1 |Schizosacc... 26 5.4 >SPAC6F6.13c |||DUF726 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 778 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 6 DVAAQQVQERLRSLH-RLIYDIEAERSRNEQ 35 D+ ++ + E LR +L+Y+IEAE +N+Q Sbjct: 699 DLVSEPIPEPLRERQSQLLYEIEAEECQNKQ 729 >SPBC2G2.06c |apl1||AP-2 adaptor complex subunit Apl1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 677 Score = 25.8 bits (54), Expect = 5.4 Identities = 10/54 (18%), Positives = 25/54 (46%) Query: 157 RPGDAVAALVRVSDNEDNWILAETTCFYRAVVNRLPASAADPYEVLFEDSSYAD 210 R D + +L+ + + + +++ E R ++ + P S +L+E+ D Sbjct: 387 RKNDCIDSLIELMNTKVTYVIQEAVIVIRDILRKYPGSYKSLVPILYENLDSLD 440 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,591 Number of Sequences: 5004 Number of extensions: 24479 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 43 Number of HSP's gapped (non-prelim): 2 length of query: 234 length of database: 2,362,478 effective HSP length: 71 effective length of query: 163 effective length of database: 2,007,194 effective search space: 327172622 effective search space used: 327172622 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -