BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001868-TA|BGIBMGA001868-PA|undefined (251 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28991-2|AAK68307.1| 679|Caenorhabditis elegans Kinesin-associa... 28 7.3 U28991-1|AAM22059.1| 696|Caenorhabditis elegans Kinesin-associa... 28 7.3 AF149287-1|AAF99086.1| 696|Caenorhabditis elegans KAP protein. 28 7.3 AB017107-1|BAA88838.1| 679|Caenorhabditis elegans Kinesin assoc... 28 7.3 Z99268-1|CAB16466.1| 715|Caenorhabditis elegans Hypothetical pr... 27 9.6 Z81573-4|CAB04627.1| 715|Caenorhabditis elegans Hypothetical pr... 27 9.6 Z49908-10|CAA90103.1| 715|Caenorhabditis elegans Hypothetical p... 27 9.6 >U28991-2|AAK68307.1| 679|Caenorhabditis elegans Kinesin-associated protein protein1, isoform b protein. Length = 679 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 173 LRLSPVSDPRLELAVVMLIIPF 194 L+L P+ DP L AV+ML+ F Sbjct: 298 LKLFPIQDPELRKAVIMLLFNF 319 >U28991-1|AAM22059.1| 696|Caenorhabditis elegans Kinesin-associated protein protein1, isoform a protein. Length = 696 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 173 LRLSPVSDPRLELAVVMLIIPF 194 L+L P+ DP L AV+ML+ F Sbjct: 315 LKLFPIQDPELRKAVIMLLFNF 336 >AF149287-1|AAF99086.1| 696|Caenorhabditis elegans KAP protein. Length = 696 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 173 LRLSPVSDPRLELAVVMLIIPF 194 L+L P+ DP L AV+ML+ F Sbjct: 315 LKLFPIQDPELRKAVIMLLFNF 336 >AB017107-1|BAA88838.1| 679|Caenorhabditis elegans Kinesin associated protein kap-1 protein. Length = 679 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Query: 173 LRLSPVSDPRLELAVVMLIIPF 194 L+L P+ DP L AV+ML+ F Sbjct: 298 LKLFPIQDPELRKAVIMLLFNF 319 >Z99268-1|CAB16466.1| 715|Caenorhabditis elegans Hypothetical protein C07E3.2 protein. Length = 715 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 208 LMYHPRGVSTKIKTKVRYQSIKKEKSGSEEDEHSADERL 246 L+ P G+ K KV + IK EK S EDE S+DE + Sbjct: 3 LLKKPAGLK---KRKVISKRIKIEKKPSSEDEGSSDEEV 38 >Z81573-4|CAB04627.1| 715|Caenorhabditis elegans Hypothetical protein C07E3.2 protein. Length = 715 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 208 LMYHPRGVSTKIKTKVRYQSIKKEKSGSEEDEHSADERL 246 L+ P G+ K KV + IK EK S EDE S+DE + Sbjct: 3 LLKKPAGLK---KRKVISKRIKIEKKPSSEDEGSSDEEV 38 >Z49908-10|CAA90103.1| 715|Caenorhabditis elegans Hypothetical protein C07E3.2 protein. Length = 715 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 208 LMYHPRGVSTKIKTKVRYQSIKKEKSGSEEDEHSADERL 246 L+ P G+ K KV + IK EK S EDE S+DE + Sbjct: 3 LLKKPAGLK---KRKVISKRIKIEKKPSSEDEGSSDEEV 38 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.327 0.139 0.464 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,107,197 Number of Sequences: 27539 Number of extensions: 229399 Number of successful extensions: 751 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 747 Number of HSP's gapped (non-prelim): 7 length of query: 251 length of database: 12,573,161 effective HSP length: 80 effective length of query: 171 effective length of database: 10,370,041 effective search space: 1773277011 effective search space used: 1773277011 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -