BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001865-TA|BGIBMGA001865-PA|IPR008089|Nucleotide sugar epimerase, IPR005886|UDP-glucose 4-epimerase, IPR001509|NAD-dependent epimerase/dehydratase (234 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.7 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 4.7 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 4.7 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 21 8.2 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 8.2 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 8.2 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 113 RDYIHVMDLASGHVAALNLLSQTHIRLKVYN 143 R Y + L + H+AA N+LS L + N Sbjct: 71 RLYYPIYKLNAAHLAAANILSPEDCELVLSN 101 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 150 VSVKELVNVFERVTKAKVP 168 +SV+ +NVF+R+ K P Sbjct: 401 ISVETKLNVFKRIGNIKAP 419 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 113 RDYIHVMDLASGHVAALNLLSQTHIRLKVYN 143 R Y + L + H+AA N+LS L + N Sbjct: 71 RLYYPIYKLNAAHLAAANILSPEDCELVLSN 101 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 150 VSVKELVNVFERVTKAKVP 168 +SV+ +NVF+R+ K P Sbjct: 403 MSVETKLNVFKRIGNIKAP 421 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 150 VSVKELVNVFERVTKAKVP 168 +SV+ +NVF+R+ K P Sbjct: 401 MSVETKLNVFKRIGNIKAP 419 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 150 VSVKELVNVFERVTKAKVP 168 +SV+ +NVF+R+ K P Sbjct: 403 MSVETKLNVFKRIGNIKAP 421 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.134 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,005 Number of Sequences: 317 Number of extensions: 2503 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 234 length of database: 114,650 effective HSP length: 55 effective length of query: 179 effective length of database: 97,215 effective search space: 17401485 effective search space used: 17401485 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -