BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001864-TA|BGIBMGA001864-PA|IPR007866|Protein of unknown function DUF714 (119 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 24 1.6 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 22 5.0 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 22 6.6 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 22 6.6 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 21 8.8 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MDPESFLDLANQVIKLKMYPYFDIAHSLLCALA 33 MDP +F + ++KL + P+F + SL+ A Sbjct: 250 MDPTAFKKIYKTILKLGLIPWF-VECSLIAVCA 281 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 95 LVFYTPFDVGYKVA 108 LVFY P D G K+A Sbjct: 272 LVFYLPADSGEKIA 285 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 95 LVFYTPFDVGYKVAKFLPVKV 115 LVFY P D G KV + + V Sbjct: 265 LVFYLPSDSGEKVTLCISILV 285 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 73 GEPILAPLKNTPQLVIGTVTW 93 G P++ L N V+G V+W Sbjct: 386 GGPLMIQLPNRRWAVVGIVSW 406 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 95 LVFYTPFDVGYKVA 108 LVFY P D G KV+ Sbjct: 259 LVFYLPSDSGEKVS 272 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,713 Number of Sequences: 2123 Number of extensions: 4386 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 5 length of query: 119 length of database: 516,269 effective HSP length: 57 effective length of query: 62 effective length of database: 395,258 effective search space: 24505996 effective search space used: 24505996 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -