BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001861-TA|BGIBMGA001861-PA|undefined (99 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_04_0015 - 15103044-15103191,15103253-15103313,15104580-151046... 29 0.61 01_01_0510 - 3723983-3724416,3724895-3725766,3725797-3726791,372... 29 0.61 05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237,364... 29 0.80 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 27 1.8 01_06_0430 + 29299970-29300031,29300162-29300294,29301057-293011... 27 1.8 05_01_0115 + 804674-804766,805729-806442 27 3.2 05_01_0503 - 4196989-4197425,4197507-4199436,4200910-4201017 26 5.6 12_02_0947 + 24680119-24681497,24682213-24682275,24683380-246842... 25 7.5 01_01_0944 + 7437536-7437652,7438468-7438704 25 7.5 11_02_0125 + 8572035-8572112,8573603-8574016,8574171-8574428,857... 25 9.9 06_03_1183 + 28237467-28237612,28238035-28238089,28238216-282383... 25 9.9 06_03_0690 + 23545198-23545305,23545437-23547246,23547265-235473... 25 9.9 05_04_0202 - 19010953-19013355 25 9.9 04_03_0592 - 17678172-17679415,17679751-17679897,17680656-17681268 25 9.9 01_06_0214 + 27595125-27595200,27595298-27595494,27596077-275960... 25 9.9 >01_04_0015 - 15103044-15103191,15103253-15103313,15104580-15104643, 15104820-15104962,15105031-15105127 Length = 170 Score = 29.1 bits (62), Expect = 0.61 Identities = 17/63 (26%), Positives = 26/63 (41%) Query: 5 GILLNLVTLTSAARRKQNDLITSDEKTDLKIPQGVFEHIKNKRDTSRRNWSRNTASNAYN 64 GIL + L+ +A R + TSDE + QG+ + + + SN Y Sbjct: 102 GILSRTIPLSESAARGTLQMETSDEALLKALEQGILIACNSSAKVPDEQQTHSLVSNEYE 161 Query: 65 PPP 67 PP Sbjct: 162 LPP 164 >01_01_0510 - 3723983-3724416,3724895-3725766,3725797-3726791, 3727332-3727439 Length = 802 Score = 29.1 bits (62), Expect = 0.61 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Query: 42 HIKNKR-DTSR-RNWSRNTASNAYNPPPYLVFNSKTGSYYPYYK-FPIENNYI 91 H+K + D S+ RNW+R S Y PY F+ + G Y+ + +N+I Sbjct: 146 HVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVPDNFI 198 >05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237, 3645328-3645525,3645614-3646249,3646352-3646606, 3646718-3646824,3646909-3650705,3650816-3651305, 3652043-3652433,3652621-3652713,3652818-3652941, 3653871-3654118 Length = 2350 Score = 28.7 bits (61), Expect = 0.80 Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 7 LLNLVTLTSAARRKQNDLITSDEKTDLKIPQGV 39 L+N +T TS R++ I DE D +P GV Sbjct: 366 LINPITSTSKVDRRERRTIEEDEDEDFCLPDGV 398 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 7 LLNLVTLTSAARRKQNDLITSDEKTDLKIPQGV 39 L+N +T T+ R++ DE D ++P GV Sbjct: 366 LINPITSTNKVDRRERRTTEEDEDEDFRLPDGV 398 >01_06_0430 + 29299970-29300031,29300162-29300294,29301057-29301160, 29302201-29302372,29302488-29302628,29302707-29303055, 29303133-29305477 Length = 1101 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Query: 34 KIPQGVFEHIKNKRDTSRRNWSRNTASNAYNPPPY 68 K+ V E+I++ SR+N+ ++ SNA+N Y Sbjct: 695 KVVHDVNENIEDHVSMSRKNYLNSSGSNAFNKERY 729 >05_01_0115 + 804674-804766,805729-806442 Length = 268 Score = 26.6 bits (56), Expect = 3.2 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 42 HIKNKRDTSRRNWSRNTASNAYNPPPYLVFNSKTGS 77 H+ +RD +R R A+ A PPP LV +S T S Sbjct: 70 HVAKERDDARDQLQRLLAAAAAKPPP-LVTSSVTDS 104 >05_01_0503 - 4196989-4197425,4197507-4199436,4200910-4201017 Length = 824 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Query: 42 HIKNKR-DTSR-RNWSRNTASNAYNPPPYLVFNSKTGSYYPYYK 83 H+K + D S+ R+W R S Y PY F+ + G Y+ Sbjct: 150 HVKLQYFDISKDRSWGRGVRSGKYPGVPYTFFSQRQGCKVTLYQ 193 >12_02_0947 + 24680119-24681497,24682213-24682275,24683380-24684239, 24684399-24684772,24685932-24686112,24686201-24686220 Length = 958 Score = 25.4 bits (53), Expect = 7.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 69 LVFNSKTGSYYPYYKFPIENNYIRRNMYKYS 99 ++ + KT Y+ Y P E + RR + KYS Sbjct: 240 ILIDVKTQRYFNYIPLPAEAKHGRRRVDKYS 270 >01_01_0944 + 7437536-7437652,7438468-7438704 Length = 117 Score = 25.4 bits (53), Expect = 7.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 56 RNTASNAYNPPPYLVFNSKTGSYY 79 RN + Y+ PYLV + K YY Sbjct: 65 RNRRPDCYSQSPYLVLDPKEHQYY 88 >11_02_0125 + 8572035-8572112,8573603-8574016,8574171-8574428, 8574781-8574966 Length = 311 Score = 25.0 bits (52), Expect = 9.9 Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 35 IPQGVFEHIKNKRDTSRRNWSRNTASNAYNPPPYLVFNSKTGSYY 79 +P F HI + +++ ++ AS PP Y V G++Y Sbjct: 97 LPSNDFNHIFQSLEQCKQSIAQECASRGLQPPQYYV-AGVPGTFY 140 >06_03_1183 + 28237467-28237612,28238035-28238089,28238216-28238354, 28238433-28238487,28238578-28238646,28239338-28239560, 28239645-28239740,28240708-28240827,28240937-28241062, 28241369-28241524,28242706-28242828,28242913-28242980, 28243119-28243254,28243365-28243530,28243615-28243853 Length = 638 Score = 25.0 bits (52), Expect = 9.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Query: 11 VTLTSAARRKQNDLITSDEKTDLKIPQGVFEHIKN 45 V LT ARR L EK + +P+ EH+ + Sbjct: 87 VMLTEEARRAATTLRVDFEKGGIHLPKDKLEHVNH 121 >06_03_0690 + 23545198-23545305,23545437-23547246,23547265-23547348, 23547732-23548048,23549498-23549605,23550038-23550046 Length = 811 Score = 25.0 bits (52), Expect = 9.9 Identities = 17/74 (22%), Positives = 33/74 (44%), Gaps = 6/74 (8%) Query: 13 LTSAARRKQNDLITSDEKTDLKIPQGVFEHIKNK-RDTS--RRNWSRNTASNAYNPPPYL 69 L+ A ++ D++ + + +I G H++ + RD + R W R + Y PY Sbjct: 121 LSGEAIERRLDILDAGRR---RISHGPTIHVRLQFRDVAGDRHGWGRGVSGARYPGVPYT 177 Query: 70 VFNSKTGSYYPYYK 83 F+ + G Y+ Sbjct: 178 FFSQRPGCRVTLYQ 191 >05_04_0202 - 19010953-19013355 Length = 800 Score = 25.0 bits (52), Expect = 9.9 Identities = 12/40 (30%), Positives = 18/40 (45%) Query: 56 RNTASNAYNPPPYLVFNSKTGSYYPYYKFPIENNYIRRNM 95 R+ NA P F+ G Y+PY+ F N Y + + Sbjct: 324 RSLGVNAILLEPVFPFHQVKGPYFPYHFFSPMNLYSSKGL 363 >04_03_0592 - 17678172-17679415,17679751-17679897,17680656-17681268 Length = 667 Score = 25.0 bits (52), Expect = 9.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Query: 4 FGILLNLVTLTSAARRKQNDLITSDEKTDLKIPQGV 39 FGILL ++T+ R+++ND+ K + QG+ Sbjct: 263 FGILLLVLTVAFLVRKRKNDIQKQLRKKYFRKNQGL 298 >01_06_0214 + 27595125-27595200,27595298-27595494,27596077-27596095, 27596257-27596309,27596642-27596719,27596836-27597116, 27598089-27598194,27599029-27599076,27599208-27599255, 27600013-27600027 Length = 306 Score = 25.0 bits (52), Expect = 9.9 Identities = 13/67 (19%), Positives = 26/67 (38%) Query: 26 TSDEKTDLKIPQGVFEHIKNKRDTSRRNWSRNTASNAYNPPPYLVFNSKTGSYYPYYKFP 85 T D + K P + + +DT + W + Y+++N+K + P+ Sbjct: 204 TLDSEERSKAPVPIPDDTSIHKDTPAQPWESRNIGLYKHKSCYMLYNAKANAEAPFISNQ 263 Query: 86 IENNYIR 92 + N R Sbjct: 264 LSKNVSR 270 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,986,485 Number of Sequences: 37544 Number of extensions: 109609 Number of successful extensions: 235 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 223 Number of HSP's gapped (non-prelim): 15 length of query: 99 length of database: 14,793,348 effective HSP length: 71 effective length of query: 28 effective length of database: 12,127,724 effective search space: 339576272 effective search space used: 339576272 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -