BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001861-TA|BGIBMGA001861-PA|undefined (99 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ277892-2|CAD12456.1|30017|Homo sapiens Titin protein. 28 4.0 AJ277892-1|CAD12455.1|26926|Homo sapiens N2B-Titin Isoform protein. 28 4.0 X90568-1|CAA62188.1|26926|Homo sapiens titin protein. 27 7.0 DQ535440-1|ABF83383.1| 124|Homo sapiens circulating B cell anti... 27 9.3 BC117170-1|AAI17171.1| 1714|Homo sapiens collagen, type XXIV, al... 27 9.3 BC116180-1|AAI16181.1| 846|Homo sapiens COL24A1 protein protein. 27 9.3 BC113654-1|AAI13655.1| 1714|Homo sapiens collagen, type XXIV, al... 27 9.3 BC037169-1|AAH37169.1| 758|Homo sapiens procollagen-lysine, 2-o... 27 9.3 AY244357-1|AAP80185.1| 1714|Homo sapiens alpha 1 type XXIV colla... 27 9.3 AL445427-1|CAI19120.1| 1714|Homo sapiens collagen, type XXIV, al... 27 9.3 AL359971-1|CAI16233.1| 1714|Homo sapiens collagen, type XXIV, al... 27 9.3 AL356059-1|CAH71121.1| 1714|Homo sapiens collagen, type XXIV, al... 27 9.3 >AJ277892-2|CAD12456.1|30017|Homo sapiens Titin protein. Length = 30000 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 39 VFEHIKNKRDTSRRNWSRNTASNAYNPPPYLVFNSKTGSYYPYYKFPIENNY 90 + ++ KRD R++WS T + + + V N + G Y +++ EN Y Sbjct: 20745 IINYVVQKRDAERKSWS--TVTTECSKTSFRVANLEEGKSY-FFRVFAENEY 20793 >AJ277892-1|CAD12455.1|26926|Homo sapiens N2B-Titin Isoform protein. Length = 26926 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 39 VFEHIKNKRDTSRRNWSRNTASNAYNPPPYLVFNSKTGSYYPYYKFPIENNY 90 + ++ KRD R++WS T + + + V N + G Y +++ EN Y Sbjct: 13321 IINYVVQKRDAERKSWS--TVTTECSKTSFRVANLEEGKSY-FFRVFAENEY 13369 >X90568-1|CAA62188.1|26926|Homo sapiens titin protein. Length = 26926 Score = 27.5 bits (58), Expect = 7.0 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 39 VFEHIKNKRDTSRRNWSRNTASNAYNPPPYLVFNSKTGSYYPYYKFPIENNY 90 + ++ KRD R++WS T + + + V N + G Y +++ EN Y Sbjct: 13321 IINYVVQKRDAERKSWS--TVTTECSKTSFRVPNLEEGKSY-FFRVFAENEY 13369 >DQ535440-1|ABF83383.1| 124|Homo sapiens circulating B cell antibody heavy chain variable region protein. Length = 124 Score = 27.1 bits (57), Expect = 9.3 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 41 EHIKNKRDTSRRNWSRNTA---SNAYNPPPYLVFNSKTGSYYPYYKFPIE 87 + +K + SR N S+NT N+ V+ GSYYPYY + ++ Sbjct: 64 DSVKGRFTISRDN-SKNTLYLQMNSLRAEDTAVYYCARGSYYPYYYYGMD 112 >BC117170-1|AAI17171.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 74 KTGSYYPYYKFPIENNYIRRNMYKY 98 K G +YP +PIEN+Y +Y Y Sbjct: 449 KEGEFYPDATYPIENSY-ETELYDY 472 >BC116180-1|AAI16181.1| 846|Homo sapiens COL24A1 protein protein. Length = 846 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 74 KTGSYYPYYKFPIENNYIRRNMYKY 98 K G +YP +PIEN+Y +Y Y Sbjct: 449 KEGEFYPDATYPIENSY-ETELYDY 472 >BC113654-1|AAI13655.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 74 KTGSYYPYYKFPIENNYIRRNMYKY 98 K G +YP +PIEN+Y +Y Y Sbjct: 449 KEGEFYPDATYPIENSY-ETELYDY 472 >BC037169-1|AAH37169.1| 758|Homo sapiens procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2 protein. Length = 758 Score = 27.1 bits (57), Expect = 9.3 Identities = 14/55 (25%), Positives = 28/55 (50%) Query: 19 RKQNDLITSDEKTDLKIPQGVFEHIKNKRDTSRRNWSRNTASNAYNPPPYLVFNS 73 +++ D T + L P+GVF +I N+ + R + N ++ YN + +F + Sbjct: 503 QREKDSPTPETFQMLSPPKGVFMYISNRHEFGRLLSTANYNTSHYNNDLWQIFEN 557 >AY244357-1|AAP80185.1| 1714|Homo sapiens alpha 1 type XXIV collagen precursor protein. Length = 1714 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 74 KTGSYYPYYKFPIENNYIRRNMYKY 98 K G +YP +PIEN+Y +Y Y Sbjct: 449 KEGEFYPDATYPIENSY-ETELYDY 472 >AL445427-1|CAI19120.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 74 KTGSYYPYYKFPIENNYIRRNMYKY 98 K G +YP +PIEN+Y +Y Y Sbjct: 449 KEGEFYPDATYPIENSY-ETELYDY 472 >AL359971-1|CAI16233.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 74 KTGSYYPYYKFPIENNYIRRNMYKY 98 K G +YP +PIEN+Y +Y Y Sbjct: 449 KEGEFYPDATYPIENSY-ETELYDY 472 >AL356059-1|CAH71121.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 74 KTGSYYPYYKFPIENNYIRRNMYKY 98 K G +YP +PIEN+Y +Y Y Sbjct: 449 KEGEFYPDATYPIENSY-ETELYDY 472 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.318 0.134 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,706,878 Number of Sequences: 224733 Number of extensions: 619683 Number of successful extensions: 1146 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 1122 Number of HSP's gapped (non-prelim): 38 length of query: 99 length of database: 73,234,838 effective HSP length: 76 effective length of query: 23 effective length of database: 56,155,130 effective search space: 1291567990 effective search space used: 1291567990 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -