BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001860-TA|BGIBMGA001860-PA|undefined (178 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0801 - 7071455-7071847 30 0.92 04_04_1222 - 31848892-31849347 30 0.92 03_06_0513 - 34432798-34433043,34433272-34433436,34433557-344338... 30 0.92 12_01_1095 + 11436012-11436053,11436322-11436595,11470730-114707... 30 1.2 08_01_0748 + 7034074-7034076,7034136-7034876 30 1.2 07_01_0814 - 6464072-6464544,6464770-6465208 30 1.2 01_06_1698 - 39264075-39264468,39264545-39264696,39264780-392648... 30 1.2 09_01_0001 - 66206-66907 29 1.6 01_02_0134 + 11470543-11470608,11471718-11471775,11472025-114722... 29 1.6 03_05_1091 + 30322035-30322739,30322861-30324043,30324114-303251... 29 2.8 12_02_0883 - 23982022-23982825 28 4.9 11_01_0062 - 476027-476044,476791-477195,477287-477574,477653-47... 28 4.9 07_03_1732 + 29109612-29110623,29110712-29110786,29111176-291113... 28 4.9 06_03_0649 + 23138442-23138842,23139576-23139849,23139929-231405... 27 6.5 04_04_1291 - 32404716-32404946,32405377-32405478,32405731-324059... 27 6.5 04_01_0438 - 5723451-5723759,5723795-5723863,5724025-5724210,572... 27 6.5 03_06_0471 + 34169562-34169892,34170121-34170347 27 6.5 03_02_0675 - 10333083-10333740,10334910-10335039,10335218-10335350 27 6.5 08_02_1413 + 26897815-26899299 27 8.5 >11_01_0801 - 7071455-7071847 Length = 130 Score = 30.3 bits (65), Expect = 0.92 Identities = 13/40 (32%), Positives = 19/40 (47%) Query: 125 TAKPLDHDVPDLKHPTDHGHKPQEQTHKSQEAPKIPDSKD 164 T PL H+ P + T + +E H+S +PDS D Sbjct: 90 TLNPLSHEAPGVDFSTAYSVSDEEFLHRSNFGKAVPDSFD 129 >04_04_1222 - 31848892-31849347 Length = 151 Score = 30.3 bits (65), Expect = 0.92 Identities = 13/40 (32%), Positives = 19/40 (47%) Query: 125 TAKPLDHDVPDLKHPTDHGHKPQEQTHKSQEAPKIPDSKD 164 T PL H+ P + T + +E H+S +PDS D Sbjct: 111 TLNPLSHEAPGVDFSTAYSVSDEEFLHRSNFGKAVPDSFD 150 >03_06_0513 - 34432798-34433043,34433272-34433436,34433557-34433842, 34434972-34435054,34435388-34435495,34435687-34435944, 34436388-34436555,34436865-34437090,34437923-34438035, 34438180-34438548,34439475-34439516,34439576-34439686, 34439883-34440086 Length = 792 Score = 30.3 bits (65), Expect = 0.92 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Query: 95 ILYIKSAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLK 137 +L IK+ G+I E+EI+ +TC L L K LD+D L+ Sbjct: 502 LLAIKNDGVILGEREIEGTTC--LESLLLRIVKVLDYDASKLR 542 >12_01_1095 + 11436012-11436053,11436322-11436595,11470730-11470762, 11470770-11471494 Length = 357 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 114 TCPDLRMELPSTAKPLDHDVPDLKHPT-DHGHKPQEQTHKSQEAPKIPDSKD 164 TCP R++L S + + VPD P D +E+ + P P+ +D Sbjct: 296 TCPPPRLQLASKIRVMGEAVPDRAEPVIDIISDEEEEEDPEEREPATPEEED 347 >08_01_0748 + 7034074-7034076,7034136-7034876 Length = 247 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 114 TCPDLRMELPSTAKPLDHDVPDLKHPT-DHGHKPQEQTHKSQEAPKIPDSKD 164 TCP R++L S + + VPD P D +E+ + P P+ +D Sbjct: 186 TCPPPRLQLASKIRVMGEAVPDRAEPVIDIISDEEEEEDPEEREPATPEEED 237 >07_01_0814 - 6464072-6464544,6464770-6465208 Length = 303 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 114 TCPDLRMELPSTAKPLDHDVPDLKHPT-DHGHKPQEQTHKSQEAPKIPDSKD 164 TCP R++L S + + VPD P D +E+ + P P+ +D Sbjct: 242 TCPPPRLQLASKIRVMGEAVPDRAEPVIDIISDEEEEEDPEEREPATPEEED 293 >01_06_1698 - 39264075-39264468,39264545-39264696,39264780-39264830, 39264946-39265122,39265256-39265348,39265489-39265555, 39265695-39265768,39266007-39266088,39266182-39266255, 39266354-39266383,39266475-39266534,39267524-39268225 Length = 651 Score = 29.9 bits (64), Expect = 1.2 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 4/87 (4%) Query: 24 PVKVVENADSVRDAKKRYGVNVVDNNNPGHADPFFAQPTVGNGYEP--IDNRPYIVNPPK 81 P++ E+ ++ R Y V + PG+ + FA E P + PP+ Sbjct: 97 PLQTPESQEAFRMLTPAYREKV--ESEPGYEERLFATRDTPEPLETSWAGELPLRLVPPR 154 Query: 82 DYNPNGNGYEPIEILYIKSAGIIFSEK 108 D+ P G +P E+ +I+ A F+E+ Sbjct: 155 DWPPPGWEVDPGELEFIREAHREFTER 181 >09_01_0001 - 66206-66907 Length = 233 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 114 TCPDLRMELPSTAKPLDHDVPDLKHPT-DHGHKPQEQTHKSQEAPKIPDSKD 164 TCP R++L S + + VPD P D +E+ + P P+ +D Sbjct: 172 TCPPPRLQLASKIRVMGEAVPDRAEPVIDIISDEEEEEDLEEREPATPEEED 223 >01_02_0134 + 11470543-11470608,11471718-11471775,11472025-11472278, 11472307-11472511,11472907-11473142 Length = 272 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/69 (23%), Positives = 30/69 (43%) Query: 103 IIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPTDHGHKPQEQTHKSQEAPKIPDS 162 +I SEKE+D+ P+ ++ K H V +++ TD P + + P + Sbjct: 103 LIVSEKELDVQVVPENEPKVQEPKKSKSHQVWNVETETDVYEDPCPAKNDVENTPVDNNG 162 Query: 163 KDNKDLPNV 171 D ++ V Sbjct: 163 TDKSEVHRV 171 >03_05_1091 + 30322035-30322739,30322861-30324043,30324114-30325105, 30326409-30326798,30326896-30330060 Length = 2144 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/39 (33%), Positives = 19/39 (48%) Query: 79 PPKDYNPNGNGYEPIEILYIKSAGIIFSEKEIDISTCPD 117 PP + NGYE + + +K+ EK + IS PD Sbjct: 461 PPGSFRTPHNGYEEVHVPALKAKPYENGEKVVKISDMPD 499 >12_02_0883 - 23982022-23982825 Length = 267 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 19 ANAQDPVKVVENADSVRDAKKRYGVNVVDNNNPGHADP 56 +++ D +K + D+ D + G VD N P H+DP Sbjct: 206 SSSMDDLKTLAPTDTNSDKETNTGNGGVDTNIPDHSDP 243 >11_01_0062 - 476027-476044,476791-477195,477287-477574,477653-477830, 478005-478133,478531-478729,478832-478970,479130-479195, 480459-480580,480672-480742,480819-480903,481335-481453, 481577-481687,481945-482117,482375-482446,482768-482862, 483361-483450,483550-483646 Length = 818 Score = 27.9 bits (59), Expect = 4.9 Identities = 17/54 (31%), Positives = 24/54 (44%) Query: 88 NGYEPIEILYIKSAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPTD 141 N YE I + S F E I + P +R LPS A+ ++ D+ L D Sbjct: 200 NHYEKYAIFMMLSKITSFEEGAILCNFLPLIREHLPSAAEEIESDIISLAQSED 253 >07_03_1732 + 29109612-29110623,29110712-29110786,29111176-29111333, 29111714-29111937,29112136-29112745 Length = 692 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Query: 123 PSTAKPLDHDVPDLKHPTDHGHKPQEQTHKSQEAPKIPDSK 163 P+ PLDH D HP D+ P+E+ Q K+ D + Sbjct: 109 PTGTSPLDHF--DQIHPGDNQFSPKEKDRSGQCLDKVDDPR 147 >06_03_0649 + 23138442-23138842,23139576-23139849,23139929-23140562, 23140771-23140826,23141178-23141282,23141295-23141535, 23142686-23142690 Length = 571 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 106 SEKEIDISTCPDLRMELPSTAKPLDHDVPDLK-HPTDHGHKPQEQTHKS 153 +E EI D+ E+ S+ L+ + D + HP H +P+E+ H++ Sbjct: 473 AEDEIMDEIMDDVLHEMMSSIGDLEREAADHRLHPRKHIKRPREEAHQN 521 >04_04_1291 - 32404716-32404946,32405377-32405478,32405731-32405910, 32406023-32406100,32407501-32407620,32407713-32407805, 32408369-32408443,32408673-32408828,32408957-32409040, 32409773-32410450,32411814-32411877,32411968-32411978 Length = 623 Score = 27.5 bits (58), Expect = 6.5 Identities = 25/89 (28%), Positives = 34/89 (38%), Gaps = 5/89 (5%) Query: 70 IDNRPYIVNPPKDYNPNGNGYEPIEILYIKSAGIIFSEKEIDISTCPDLRMELPSTAKPL 129 + N +P KD G G I ++ EKE P + E + AKPL Sbjct: 135 VQNSNNEAHPQKDLPTEGMGPPEIPTTDEQTVSSEEKEKETLAQGTPQIPDEHGAAAKPL 194 Query: 130 DHDVP--DLKHPTDH---GHKPQEQTHKS 153 D+P D+ D G EQT K+ Sbjct: 195 SQDIPVIDINPSVDDKATGEVLPEQTDKT 223 >04_01_0438 - 5723451-5723759,5723795-5723863,5724025-5724210, 5724297-5724558,5724662-5724960,5725040-5725453, 5725533-5725899,5726002-5726146,5726562-5727558 Length = 1015 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/40 (27%), Positives = 19/40 (47%) Query: 130 DHDVPDLKHPTDHGHKPQEQTHKSQEAPKIPDSKDNKDLP 169 D D PD+ P+ G P T + + +PD + + +P Sbjct: 948 DFDFPDIIGPSQLGGAPPVHTQEQSPSTPLPDPRATRAVP 987 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Query: 49 NNPGHADPFFAQPTVGNG-YEPIDNRPYIVNPPKDYNPNGNGYEP 92 N+PG P+ G Y P P PP Y P+ GY P Sbjct: 37 NSPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQGGYPP 81 >03_02_0675 - 10333083-10333740,10334910-10335039,10335218-10335350 Length = 306 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 123 PSTAKPLDHDVPDLKHPTDHGHKPQEQ-THKSQEAPKIPDSK 163 P P+ HD P H H+ Q+ TH +AP PDS+ Sbjct: 151 PPPCLPVFHDAPYFA-ALQHQHQQQQVVTHVDADAPASPDSQ 191 >08_02_1413 + 26897815-26899299 Length = 494 Score = 27.1 bits (57), Expect = 8.5 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 33 SVRDAKKRYGVNVVDNNNPGHADPFFAQPTVGNGYEPIDNRPY---IVNPPKDY 83 ++ + K RY +++ NNPG P A EP R Y + PP+++ Sbjct: 114 AMEEHKWRYLRDLLARNNPGGDAPLAAYARAARELEPAARRRYAEPVALPPREF 167 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.314 0.136 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,208,407 Number of Sequences: 37544 Number of extensions: 296235 Number of successful extensions: 483 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 475 Number of HSP's gapped (non-prelim): 20 length of query: 178 length of database: 14,793,348 effective HSP length: 78 effective length of query: 100 effective length of database: 11,864,916 effective search space: 1186491600 effective search space used: 1186491600 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -