BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001860-TA|BGIBMGA001860-PA|undefined (178 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 ... 33 0.11 At3g42460.1 68416.m04398 hypothetical protein several hypothetic... 31 0.58 At1g53080.1 68414.m06010 legume lectin family protein 31 0.58 At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar ... 29 1.8 At5g05490.2 68418.m00593 cohesion family protein SYN1, splice va... 29 2.3 At5g05490.1 68418.m00592 cohesion family protein SYN1, splice va... 29 2.3 At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase fa... 29 2.3 At1g20960.1 68414.m02624 U5 small nuclear ribonucleoprotein heli... 28 3.1 At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product... 28 4.1 At5g28610.1 68418.m03492 expressed protein 27 5.4 At4g34430.3 68417.m04892 DNA-binding family protein contains Pfa... 27 5.4 At1g15140.3 68414.m01810 oxidoreductase NAD-binding domain-conta... 27 5.4 At1g15140.2 68414.m01809 oxidoreductase NAD-binding domain-conta... 27 5.4 At1g15140.1 68414.m01808 oxidoreductase NAD-binding domain-conta... 27 5.4 At5g38190.1 68418.m04602 myosin heavy chain-related 27 7.1 At5g36780.1 68418.m04406 hypothetical protein 27 7.1 At5g36690.1 68418.m04391 hypothetical protein 27 7.1 At3g61950.2 68416.m06958 basic helix-loop-helix (bHLH) family pr... 27 7.1 At3g61950.1 68416.m06957 basic helix-loop-helix (bHLH) family pr... 27 7.1 At1g17380.1 68414.m02120 expressed protein 27 7.1 At3g01490.1 68416.m00073 protein kinase, putative similar to ATM... 27 9.4 At2g43970.2 68415.m05468 La domain-containing protein contains P... 27 9.4 At2g32210.1 68415.m03936 expressed protein 27 9.4 At2g30040.1 68415.m03653 protein kinase family protein contains ... 27 9.4 >At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 family protein contains Pfam domain PF04153: NOT2 / NOT3 / NOT5 family Length = 843 Score = 33.1 bits (72), Expect = 0.11 Identities = 24/81 (29%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Query: 61 PTVGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIEILYIKSAGIIFSEKEIDISTCPDLRM 120 P G G I N+P PP NG+ + I+ E + T P +M Sbjct: 377 PLRGIGRVGIPNQPQPSQPPSPIPANGSRISATSAAEVAKRNIMGVESNVQPLTSPLSKM 436 Query: 121 ELPSTAKPLDHDVPDLKHPTD 141 LP TAK D D +P D Sbjct: 437 VLPPTAKGNDGTASD-SNPGD 456 >At3g42460.1 68416.m04398 hypothetical protein several hypothetical proteins - Arabidopsis thaliana Length = 202 Score = 30.7 bits (66), Expect = 0.58 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query: 26 KVVENADSVRDAKKRYGVNVVDNNNPGHADPFFAQPTVGNGYEPIDN 72 KV+ N+D V+ YG+N++D DP P N + DN Sbjct: 50 KVIPNSDPVKTTSAEYGINLMDKTVVTSGDP--NTPIKFNNFTSFDN 94 >At1g53080.1 68414.m06010 legume lectin family protein Length = 283 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Query: 48 NNNPGHADPFFAQPTVGNGYEPIDNRPY--IVNPPKDYNPNGN 88 N NPGH F PTV Y+ R + +VN + NPN + Sbjct: 106 NPNPGHGIAFIVVPTVAYEYDQDSTRGFLGLVNLTTNGNPNNH 148 >At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar to variable surface lipoprotein Vsp422-3 (GI:15384285) [Mycoplasma bovis]; similar to glycine-rich protein atGRP-6, Arabidopsis thaliana, PIR:T49893 Length = 225 Score = 29.1 bits (62), Expect = 1.8 Identities = 22/93 (23%), Positives = 35/93 (37%), Gaps = 1/93 (1%) Query: 78 NPPKDYNPNGNGYEPIEILYIKSAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLK 137 NP K+ P P + K ++ +K ++ P + P KP + P K Sbjct: 116 NPLKEDKPPERDKLPRKDKPSKEDNLLKGDKPVEEDKLPAEEEKPPQKDKPAEGHKPPQK 175 Query: 138 HPTDHGHKPQEQTHKSQ-EAPKIPDSKDNKDLP 169 G KP E+ Q + P D +D+P Sbjct: 176 DKPAEGDKPVEEDKPPQKDKPAEGDKHVEEDMP 208 >At5g05490.2 68418.m00593 cohesion family protein SYN1, splice variant 1 (SYN1) identical to SYN1 splice variant 1 [Arabidopsis thaliana] GI:6453715 Length = 617 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 9/74 (12%) Query: 104 IFSEKEIDISTCPDLRMELPST---AKPLDHDVPDLKHPTDHGHKPQEQTHK-----SQE 155 I + E +++ P E+P+T + P HD+P+ +PT + Q++ + E Sbjct: 199 IEGDDETQMNSNPREGAEIPTTLIPSPPRHHDIPEGVNPTSPQRQEQQENRRDGFAEQME 258 Query: 156 APKIPDSKDNKDLP 169 IPD K+ D P Sbjct: 259 EQNIPD-KEEHDRP 271 >At5g05490.1 68418.m00592 cohesion family protein SYN1, splice variant 1 (SYN1) identical to SYN1 splice variant 1 [Arabidopsis thaliana] GI:6453715 Length = 627 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 9/74 (12%) Query: 104 IFSEKEIDISTCPDLRMELPST---AKPLDHDVPDLKHPTDHGHKPQEQTHK-----SQE 155 I + E +++ P E+P+T + P HD+P+ +PT + Q++ + E Sbjct: 209 IEGDDETQMNSNPREGAEIPTTLIPSPPRHHDIPEGVNPTSPQRQEQQENRRDGFAEQME 268 Query: 156 APKIPDSKDNKDLP 169 IPD K+ D P Sbjct: 269 EQNIPD-KEEHDRP 281 >At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase family protein simlar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 585 Score = 28.7 bits (61), Expect = 2.3 Identities = 26/118 (22%), Positives = 44/118 (37%), Gaps = 9/118 (7%) Query: 55 DPFFAQPTVGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIEILYIKSAGIIFSEKEIDIST 114 DP QP + + D R + + P D++P+ G +S + D S Sbjct: 183 DPSIPQPGLDRRFSVCD-RVFFSHRPSDFDPSFRGSSS------SHRPSDYSRRPSDYSR 235 Query: 115 CPDLRMELPS--TAKPLDHDVPDLKHPTDHGHKPQEQTHKSQEAPKIPDSKDNKDLPN 170 P PS + +P D D P+D+ +P + + S + D D P+ Sbjct: 236 RPSDYSRRPSDYSRRPSDSRPSDYSRPSDYYSRPSDYSRPSDFSRSSDDDNGLGDSPS 293 >At1g20960.1 68414.m02624 U5 small nuclear ribonucleoprotein helicase, putative similar to SP|O75643 U5 small nuclear ribonucleoprotein 200 kDa helicase {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF02889: Sec63 domain Length = 2171 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 79 PPKDYNPNGNGYEPIEILYIKSAGIIFSEKEIDISTCPD 117 PP Y +G GY+ + + ++ S + +EK + I+ PD Sbjct: 456 PPGSYRSHGKGYDEVHVPWV-SKKVDRNEKLVKITEMPD 493 >At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product [Arabidopsis thaliana] GI:871782 Length = 748 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 143 GHKPQEQTHKSQ-EAPKIPDSKDNKDLPNVGQMGG 176 G QE+ HK+ E P++PD + L + +M G Sbjct: 510 GSSEQEEQHKANNEPPELPDESQSFSLAEISRMKG 544 >At5g28610.1 68418.m03492 expressed protein Length = 123 Score = 27.5 bits (58), Expect = 5.4 Identities = 17/73 (23%), Positives = 34/73 (46%), Gaps = 2/73 (2%) Query: 107 EKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPTDHGHKPQEQTHKSQEAPKIPDSKDNK 166 EK+ D R ++ + L + +KHP HG QE+ + E ++ + ++ + Sbjct: 37 EKDEDKKKEGSKREKIAAAMVGLGATLKKVKHPRHHGSGGQEEQEGAAEEEEVEEEEEEE 96 Query: 167 DLPNVG--QMGGK 177 + + G + GGK Sbjct: 97 EEDDGGDEEEGGK 109 >At4g34430.3 68417.m04892 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 983 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/71 (21%), Positives = 37/71 (52%), Gaps = 5/71 (7%) Query: 100 SAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPTDHGHKPQEQTHKSQEAPKI 159 ++G++ + + I P + P+ +K D + D D+ HK + KS++A ++ Sbjct: 577 NSGMLLATRHCYILEDPPDNKKDPTKSKSADAEGND-----DNSHKDDQPEEKSKKAEEV 631 Query: 160 PDSKDNKDLPN 170 + D++++P+ Sbjct: 632 SLNSDDREMPD 642 >At1g15140.3 68414.m01810 oxidoreductase NAD-binding domain-containing protein Contains Pfam profile PF00175: Oxidoreductase NAD-binding domain; ESTs gb|H76345 and gb|AA651465 come from this gene Length = 271 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 90 YEPIEILYIKSAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPT 140 + P + I+SA IDIS PDL + L VPD++ P+ Sbjct: 58 WTPAPLSLIESAAESLFHISIDISNAPDLVASYTRPGQYLQIRVPDVEKPS 108 >At1g15140.2 68414.m01809 oxidoreductase NAD-binding domain-containing protein Contains Pfam profile PF00175: Oxidoreductase NAD-binding domain; ESTs gb|H76345 and gb|AA651465 come from this gene Length = 271 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 90 YEPIEILYIKSAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPT 140 + P + I+SA IDIS PDL + L VPD++ P+ Sbjct: 58 WTPAPLSLIESAAESLFHISIDISNAPDLVASYTRPGQYLQIRVPDVEKPS 108 >At1g15140.1 68414.m01808 oxidoreductase NAD-binding domain-containing protein Contains Pfam profile PF00175: Oxidoreductase NAD-binding domain; ESTs gb|H76345 and gb|AA651465 come from this gene Length = 295 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 90 YEPIEILYIKSAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPT 140 + P + I+SA IDIS PDL + L VPD++ P+ Sbjct: 58 WTPAPLSLIESAAESLFHISIDISNAPDLVASYTRPGQYLQIRVPDVEKPS 108 >At5g38190.1 68418.m04602 myosin heavy chain-related Length = 969 Score = 27.1 bits (57), Expect = 7.1 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Query: 109 EIDISTCPDLRMELPSTAKPLD-HDVPDLKHPTDHGHKPQEQTHKSQEAPK 158 ++D + D E P+D VP LKH + KPQ+Q KS PK Sbjct: 268 KVDRNLVEDPSAETLREQAPIDWKQVPCLKHKKQNKRKPQKQ--KSSARPK 316 >At5g36780.1 68418.m04406 hypothetical protein Length = 576 Score = 27.1 bits (57), Expect = 7.1 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 68 EPIDNRPYIVNPPKDYNPNGNGYEPIEILYI-KSAGIIFSEKEIDISTCPDLRMELPSTA 126 E +D+ YI +Y G E + K GII SEKE I+ + +EL Sbjct: 165 EELDHLSYIAQYQIEYGSIGLEEEDWMLKETEKPDGIILSEKEASINRVKSMALELNEVK 224 Query: 127 KPLD 130 LD Sbjct: 225 NELD 228 >At5g36690.1 68418.m04391 hypothetical protein Length = 576 Score = 27.1 bits (57), Expect = 7.1 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 68 EPIDNRPYIVNPPKDYNPNGNGYEPIEILYI-KSAGIIFSEKEIDISTCPDLRMELPSTA 126 E +D+ YI +Y G E + K GII SEKE I+ + +EL Sbjct: 165 EELDHLSYIAQYQIEYGSIGLEEEDWMLKETEKPDGIILSEKEASINRVKSMALELNEVK 224 Query: 127 KPLD 130 LD Sbjct: 225 NELD 228 >At3g61950.2 68416.m06958 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 307 Score = 27.1 bits (57), Expect = 7.1 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 6/75 (8%) Query: 97 YIKSAGIIFSEKEIDISTCPDLRMELPS-TAKPLDHDVPDLKHPTDHGHKPQEQTHKSQE 155 +++ A S +EI S M LPS T+ PL K +H PQE T + ++ Sbjct: 55 FMEGANQAVSSQEIPFSQA---NMTLPSSTSSPLSAH-SRRKRKINH-LLPQEMTREKRK 109 Query: 156 APKIPDSKDNKDLPN 170 K SK+N+++ N Sbjct: 110 RRKTKPSKNNEEIEN 124 >At3g61950.1 68416.m06957 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 358 Score = 27.1 bits (57), Expect = 7.1 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 6/75 (8%) Query: 97 YIKSAGIIFSEKEIDISTCPDLRMELPS-TAKPLDHDVPDLKHPTDHGHKPQEQTHKSQE 155 +++ A S +EI S M LPS T+ PL K +H PQE T + ++ Sbjct: 106 FMEGANQAVSSQEIPFSQA---NMTLPSSTSSPLSAH-SRRKRKINH-LLPQEMTREKRK 160 Query: 156 APKIPDSKDNKDLPN 170 K SK+N+++ N Sbjct: 161 RRKTKPSKNNEEIEN 175 >At1g17380.1 68414.m02120 expressed protein Length = 274 Score = 27.1 bits (57), Expect = 7.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 133 VPDLKHPTDHGHKPQEQTHKSQE 155 +PDL PTD+ H +EQ + ++ Sbjct: 153 LPDLNEPTDNNHLTKEQQQQQEQ 175 >At3g01490.1 68416.m00073 protein kinase, putative similar to ATMRK1 [Arabidopsis thaliana] gi|2351097|dbj|BAA22079 Length = 411 Score = 26.6 bits (56), Expect = 9.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 28 VENADSVRDAKKRYGVNVVDNNNPGHADPFFAQPTVGNGYEPIDN 72 +E S+ D + + NN GH F +P +G GY +N Sbjct: 38 MEKRKSLSDGEDNVNNTRHNQNNFGHRQLVFQRPLLGGGYSNNNN 82 >At2g43970.2 68415.m05468 La domain-containing protein contains Pfam profile PF05383: La domain Length = 529 Score = 26.6 bits (56), Expect = 9.4 Identities = 19/70 (27%), Positives = 28/70 (40%), Gaps = 1/70 (1%) Query: 86 NGNGYEPIEILYIKSAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPTDHGHK 145 NG+G P KS G +FS K ++S + R L L H + K G K Sbjct: 322 NGSGAPPAARSAAKSDGTLFSNKVTELSEAGNWRSGL-KVRLMLKHQTKEPKQGQGRGRK 380 Query: 146 PQEQTHKSQE 155 + + +E Sbjct: 381 GHDADVEHEE 390 >At2g32210.1 68415.m03936 expressed protein Length = 71 Score = 26.6 bits (56), Expect = 9.4 Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 69 PIDNRPYIVNPPKDYNPNGNGYEPIEILYIKSAG 102 P+ PY+ PP Y N + + + KS G Sbjct: 17 PVSTGPYVAPPPLGYPTNDTSHATVATVETKSKG 50 >At2g30040.1 68415.m03653 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 463 Score = 26.6 bits (56), Expect = 9.4 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 6/44 (13%) Query: 99 KSAGIIFSEKEIDISTCPDLRMELPSTAKPLDHDVPDLKHPTDH 142 K G +F+ K ID++TC LPS A+ L++++ L+ H Sbjct: 37 KIDGGLFAVKSIDLATC------LPSQAESLENEIVILRSMKSH 74 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.314 0.136 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,115,133 Number of Sequences: 28952 Number of extensions: 248092 Number of successful extensions: 465 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 455 Number of HSP's gapped (non-prelim): 24 length of query: 178 length of database: 12,070,560 effective HSP length: 77 effective length of query: 101 effective length of database: 9,841,256 effective search space: 993966856 effective search space used: 993966856 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -