BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001859-TA|BGIBMGA001859-PA|IPR003593|AAA ATPase, IPR013594|Dynein heavy chain, N-terminal region 1, IPR013602|Dynein heavy chain, N-terminal region 2, IPR011704|ATPase associated with various cellular activities, AAA-5, IPR004273|Dynein heavy chain (4153 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 29 0.89 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 28 1.5 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 28 1.5 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 26 4.7 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 25 8.3 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 28.7 bits (61), Expect = 0.89 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 3/96 (3%) Query: 977 LVDGIEQFFKEYRKLPKIVRLSSTGLMLD--LKMKQFKGVVPLMVSLKNEAMRERHWKEL 1034 LV I +FF EYR LP+ V GL+LD K + K V P ++ L EA + + + Sbjct: 181 LVPKIAEFF-EYRVLPRKVTDFFEGLILDNMQKREAEKIVRPDLIHLLMEARKGKLKHDN 239 Query: 1035 MAKTGQDFDMSPDRFTLENMFAMELHKYQDVAEEIV 1070 + G+ F + +N +EL + VA+ ++ Sbjct: 240 SNEGGEGFATVEESEIGKNTKQVELTDEKIVAQALL 275 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 27.9 bits (59), Expect = 1.5 Identities = 20/68 (29%), Positives = 40/68 (58%), Gaps = 6/68 (8%) Query: 362 LTVHKLIQEYNLEFQPNFDKDLFLVIHEA-EL-MEQLGFDVPS--NVRDVAMQKSRLFYE 417 L +L+ E N QP D+ LF+V H+A EL +Q+ +++ S N+ +++S+ Sbjct: 34 LEAQRLLSEQNN--QPVHDEHLFIVTHQAYELWFKQIIYELDSIRNIFSDVLEESQTLEI 91 Query: 418 LEALSKII 425 L+ L++++ Sbjct: 92 LKRLNRVV 99 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 27.9 bits (59), Expect = 1.5 Identities = 20/68 (29%), Positives = 40/68 (58%), Gaps = 6/68 (8%) Query: 362 LTVHKLIQEYNLEFQPNFDKDLFLVIHEA-EL-MEQLGFDVPS--NVRDVAMQKSRLFYE 417 L +L+ E N QP D+ LF+V H+A EL +Q+ +++ S N+ +++S+ Sbjct: 34 LEAQRLLSEQNN--QPVHDEHLFIVTHQAYELWFKQIIYELDSIRNIFSDVLEESQTLEI 91 Query: 418 LEALSKII 425 L+ L++++ Sbjct: 92 LKRLNRVV 99 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 26.2 bits (55), Expect = 4.7 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 12/94 (12%) Query: 3165 TTRASRFPLCI---DPQTQALTWIKKKEA-KNNLKVLSFNDPQFLRQLEMAIKYGMPVLF 3220 T AS F +CI P+ Q + + ++ +++ + ++FND ++ LE VL Sbjct: 1 TAAASSFFICILGVYPEIQEKVYQELRDIFQDSDRPITFNDTLQMKYLER-------VLL 53 Query: 3221 QDVNEYID-PVVDNVLEKNIKVESGRTFVMLGST 3253 + + Y P++ V+ + +K+ SG + +G+T Sbjct: 54 ETLRMYPPVPIITRVINEEVKLASGDYTLPVGTT 87 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 25.4 bits (53), Expect = 8.3 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 7/47 (14%) Query: 3884 NIAVDVLSKLPT----LYEIWR---VRKQFEMNITPTLVVLLQELER 3923 N+ D+LS+ P+ YE R + FE+N TP ++ L+ +L++ Sbjct: 24 NVVADILSRYPSDGEASYEYPREQPIVAMFEVNNTPEILQLMSDLKQ 70 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 917,570 Number of Sequences: 317 Number of extensions: 39265 Number of successful extensions: 100 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 100 Number of HSP's gapped (non-prelim): 5 length of query: 4153 length of database: 114,650 effective HSP length: 71 effective length of query: 4082 effective length of database: 92,143 effective search space: 376127726 effective search space used: 376127726 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -