BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001859-TA|BGIBMGA001859-PA|IPR003593|AAA ATPase, IPR013594|Dynein heavy chain, N-terminal region 1, IPR013602|Dynein heavy chain, N-terminal region 2, IPR011704|ATPase associated with various cellular activities, AAA-5, IPR004273|Dynein heavy chain (4153 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 27 4.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 9.8 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 26.6 bits (56), Expect = 4.2 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Query: 337 YENVRSPSSVSLLAKEGLT---DVTWRDLTVHKLIQEYNLEFQPNFDK 381 Y N V+L+ K L DV+W+ ++K E N+E+ P FD+ Sbjct: 123 YNNADGNYEVTLMTKATLKYTGDVSWKPPAIYKSSCEINVEYFP-FDE 169 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.4 bits (53), Expect = 9.8 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 649 LNRLTAFPRWMKKTCLPCPPQRVAEATGNEYYVFSY-FEDI 688 L+R+ M+KT P P E+TGN Y+++ F D+ Sbjct: 292 LSRMNLTLAKMEKTSKPLPMVDNPESTGNLVYIYNNPFSDV 332 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,134,688 Number of Sequences: 429 Number of extensions: 49688 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 115 Number of HSP's gapped (non-prelim): 7 length of query: 4153 length of database: 140,377 effective HSP length: 72 effective length of query: 4081 effective length of database: 109,489 effective search space: 446824609 effective search space used: 446824609 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -