GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001858-TA|BGIBMGA001858-PA|IPR013594|Dynein heavy chain,
N-terminal region 1
         (529 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY545000-1|AAS50159.2|  126|Apis mellifera profilin protein.           23   6.3  

>AY545000-1|AAS50159.2|  126|Apis mellifera profilin protein.
          Length = 126

 Score = 23.0 bits (47), Expect = 6.3
 Identities = 9/30 (30%), Positives = 16/30 (53%)

Query: 315 HIMDETASQSTRIFEEPIKSDQQKSTAEEV 344
           H M  T +    ++E+PI+  Q  S  E++
Sbjct: 88  HCMKTTQAVVVSLYEDPIQPQQAASVVEKL 117


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.136    0.395 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,123
Number of Sequences: 429
Number of extensions: 5463
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 529
length of database: 140,377
effective HSP length: 61
effective length of query: 468
effective length of database: 114,208
effective search space: 53449344
effective search space used: 53449344
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 46 (22.6 bits)