BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001855-TA|BGIBMGA001855-PA|IPR012581|NUC156 (158 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83114-1|CAB63234.1| 549|Caenorhabditis elegans Hypothetical pr... 40 8e-04 AF229855-1|AAF71303.1| 1497|Caenorhabditis elegans dual oxidase ... 27 8.2 AF100661-4|AAC68973.1| 481|Caenorhabditis elegans Hypothetical ... 27 8.2 AF077541-9|AAC64633.1| 909|Caenorhabditis elegans Cysteinyl trn... 27 8.2 AF077541-8|AAK68426.1| 908|Caenorhabditis elegans Cysteinyl trn... 27 8.2 AF043697-1|AAK73882.1| 1497|Caenorhabditis elegans Blistered cut... 27 8.2 >Z83114-1|CAB63234.1| 549|Caenorhabditis elegans Hypothetical protein K09B11.2 protein. Length = 549 Score = 39.9 bits (89), Expect = 8e-04 Identities = 26/98 (26%), Positives = 51/98 (52%), Gaps = 12/98 (12%) Query: 19 RVELKNLCIGLNVRVPEDTVTKVINGKIVALC-KLTTVDKGKMFTLGD-----------K 66 R E +C+ +++ V + V IN +I+ALC T + K++ D Sbjct: 397 RFENVTICVPVDLLVEDSHVFSSINTQIMALCINNTDLKPRKLYGKDDLPSICVIDGNSP 456 Query: 67 AIPCLGNGLVRCVDFEKQVLYIITPLPVGILSQVNTLV 104 A+ C+G G++R V E+++++++TP+ + L + LV Sbjct: 457 ALQCIGFGIIRGVSVEERIIFVVTPVDLLKLEEPPVLV 494 >AF229855-1|AAF71303.1| 1497|Caenorhabditis elegans dual oxidase protein. Length = 1497 Score = 26.6 bits (56), Expect = 8.2 Identities = 17/64 (26%), Positives = 31/64 (48%) Query: 73 NGLVRCVDFEKQVLYIITPLPVGILSQVNTLVYSDWAPEIVGQEKYLPDNIIVPYRITSQ 132 +GL + +D K Y++ P+ + ++ ++ L+ EIV E D I + YR + Sbjct: 1179 HGLPKLLDSPKFGYYVVGPIVLFVIDRIIGLMQYYKKLEIVNAEILPSDIIYIEYRRPRE 1238 Query: 133 QKQK 136 K K Sbjct: 1239 FKYK 1242 >AF100661-4|AAC68973.1| 481|Caenorhabditis elegans Hypothetical protein H20E11.1a protein. Length = 481 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/43 (25%), Positives = 21/43 (48%) Query: 111 EIVGQEKYLPDNIIVPYRITSQQKQKQLMITPRRRFNPLVLLN 153 ++ G +PDN +VP +++ + P+ F + LLN Sbjct: 34 QVAGNAINIPDNSVVPVALSANFNCSYTIKPPKNTFAKITLLN 76 >AF077541-9|AAC64633.1| 909|Caenorhabditis elegans Cysteinyl trna synthetase protein1, isoform a protein. Length = 909 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 5 RQNNYEKSRFFSCFRVELKNLCIGLNVR 32 + N++K FF C + LK I LNV+ Sbjct: 14 KNRNFKKKPFFGCGFLNLKRFLICLNVK 41 >AF077541-8|AAK68426.1| 908|Caenorhabditis elegans Cysteinyl trna synthetase protein1, isoform b protein. Length = 908 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 5 RQNNYEKSRFFSCFRVELKNLCIGLNVR 32 + N++K FF C + LK I LNV+ Sbjct: 14 KNRNFKKKPFFGCGFLNLKRFLICLNVK 41 >AF043697-1|AAK73882.1| 1497|Caenorhabditis elegans Blistered cuticle protein 3 protein. Length = 1497 Score = 26.6 bits (56), Expect = 8.2 Identities = 17/64 (26%), Positives = 31/64 (48%) Query: 73 NGLVRCVDFEKQVLYIITPLPVGILSQVNTLVYSDWAPEIVGQEKYLPDNIIVPYRITSQ 132 +GL + +D K Y++ P+ + ++ ++ L+ EIV E D I + YR + Sbjct: 1179 HGLPKLLDSPKFGYYVVGPIVLFVIDRIIGLMQYYKKLEIVNAEILPSDIIYIEYRRPRE 1238 Query: 133 QKQK 136 K K Sbjct: 1239 FKYK 1242 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.324 0.141 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,898,836 Number of Sequences: 27539 Number of extensions: 155936 Number of successful extensions: 269 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 262 Number of HSP's gapped (non-prelim): 6 length of query: 158 length of database: 12,573,161 effective HSP length: 76 effective length of query: 82 effective length of database: 10,480,197 effective search space: 859376154 effective search space used: 859376154 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -