BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001850-TA|BGIBMGA001850-PA|IPR000326|Phosphoesterase, PA-phosphatase related, IPR008934|Acid phosphatase/vanadium-dependent haloperoxidase (240 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 27 0.37 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 6.1 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 27.5 bits (58), Expect = 0.37 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 39 TVTSLILMTTIFIIPIGVFMITEYIFTPNEIPLSDRTMRAFLK 81 ++TS IL + ++ IGV +YIFT E+ + D M K Sbjct: 1004 SITS-ILFPLMLVVMIGVRKSLDYIFTKRELKILDDIMPEMTK 1045 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.4 bits (48), Expect = 6.1 Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 214 WDVLIGSAIGLITLLYTVKELLR 236 W +L+GS +G ++ V L R Sbjct: 291 WSILLGSIVGAVSPAVVVPRLFR 313 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.329 0.140 0.460 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,937 Number of Sequences: 2123 Number of extensions: 7970 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 2 length of query: 240 length of database: 516,269 effective HSP length: 62 effective length of query: 178 effective length of database: 384,643 effective search space: 68466454 effective search space used: 68466454 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -