BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001848-TA|BGIBMGA001848-PA|undefined (340 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0521 + 4083594-4083763,4083765-4083963,4084059-4084244,408... 32 0.57 07_03_1603 + 28080561-28080706,28080752-28080834,28082055-280820... 30 3.1 12_01_0340 - 2605770-2605916,2606353-2606595,2607260-2607531,260... 29 5.3 02_05_0491 + 29470575-29471351,29471574-29471806,29472697-294728... 29 7.1 02_04_0427 - 22809481-22810335 28 9.3 >11_01_0521 + 4083594-4083763,4083765-4083963,4084059-4084244, 4085834-4086025,4086979-4087200,4089238-4089444, 4089681-4090082,4090201-4090230,4090307-4090318 Length = 539 Score = 32.3 bits (70), Expect = 0.57 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 4/100 (4%) Query: 89 DIGDNKADLEYDLHYSLSLKGTSSMHFKERLEIITYTDLVAPMRMRFVFRQPPLAYVANI 148 D G+ + DL + L G +M F +T +VA + + FV L Y A I Sbjct: 425 DFGEYEKDLVIQVSLVCGLPGVMAMVFAHLASGPFWTSIVASLTLYFVIYSITLVYYAFI 484 Query: 149 FALPFSTGV----WMAVAIASIASTVTLYITSLWEIRIEK 184 LP+S + V + +I V L + +W ++K Sbjct: 485 RLLPWSPWTRLQFYATVILLAIFLIVVLTMLIVWGSFVKK 524 >07_03_1603 + 28080561-28080706,28080752-28080834,28082055-28082092, 28083639-28084051,28084390-28084458,28084868-28084871, 28086638-28086763 Length = 292 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Query: 12 RNLMGHHLTMANII-QDSNTTKYYLPRDDRLQLHHDAVAKVCWVFAKVAFELLNATPRYI 70 R + H+L + +I Q + + + + Q D + CW+ KVA E+ N Sbjct: 223 RGRVTHYLRLCSIWRQQTKEIEMHFSSCKKTQGEKDCSGEPCWLLNKVAGEMFNTK---- 278 Query: 71 FSYRFGYKVNGQWS 84 F +RFG + W+ Sbjct: 279 FGWRFGSWDSQDWN 292 >12_01_0340 - 2605770-2605916,2606353-2606595,2607260-2607531, 2607691-2607733,2607822-2607899,2608026-2608085, 2608272-2608331,2609440-2609577,2609655-2609767, 2610333-2610569,2610867-2610918 Length = 480 Score = 29.1 bits (62), Expect = 5.3 Identities = 16/40 (40%), Positives = 18/40 (45%) Query: 152 PFSTGVWMAVAIASIASTVTLYITSLWEIRIEKNPTQLDG 191 PFST A A A+ TL I W +R PT DG Sbjct: 97 PFSTAAAAATATATARPPATLDIFPSWPMRRSSLPTPKDG 136 >02_05_0491 + 29470575-29471351,29471574-29471806,29472697-29472856, 29473149-29473394,29473492-29473628,29473874-29474207, 29474283-29474444,29474717-29474791,29474866-29474966, 29475042-29475111,29475210-29475266,29475357-29475418, 29475505-29475577,29475663-29475884 Length = 902 Score = 28.7 bits (61), Expect = 7.1 Identities = 25/102 (24%), Positives = 48/102 (47%), Gaps = 3/102 (2%) Query: 25 IQDSNTTKYYLPRDDRLQLHHDAVAKVCWVF-AKVAFELLNATPRYIFSYRF-GYKVNGQ 82 ++D +T + +PR +L + + F +++E + P + S++F Y V+G Sbjct: 453 VKDESTDQLLVPRMKKLGIKMFRSIRHTKDFDVSISYEKASELPPGVTSHKFVEYSVSGL 512 Query: 83 WSGMVRDIGDN-KADLEYDLHYSLSLKGTSSMHFKERLEIIT 123 + N A ++ +LH+SLS G S+ E + IT Sbjct: 513 TDASEKYSSRNLSAPIKANLHFSLSRSGIISLDRAEAVIEIT 554 >02_04_0427 - 22809481-22810335 Length = 284 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Query: 91 GDNKADLEYDLHYSLSLKGTSSM----HFKERLEII 122 GDN + YD Y+ + G +S HFKE +E++ Sbjct: 6 GDNMHGVPYDFRYAAPIPGQASQVYSRHFKEFMELV 41 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.324 0.137 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,923,399 Number of Sequences: 37544 Number of extensions: 342269 Number of successful extensions: 877 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 875 Number of HSP's gapped (non-prelim): 5 length of query: 340 length of database: 14,793,348 effective HSP length: 83 effective length of query: 257 effective length of database: 11,677,196 effective search space: 3001039372 effective search space used: 3001039372 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -